Sequence:
download
CE01889sequence.fasta
>MOG-5 MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSLTATILRIVQSMTAVKKKN KKGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAKEKEDNEDDLMAQLEKMEGRYESEKRLQKESDSKRNRSRSR SRSRDRKRRRSRSGDRDRRRRSRSREDRRDRDRRDRDRDRDRGRGDRRGDDRQRDRRDRRDDGGARKSEVAEIGKIYDGR VNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVNKIENGKISLSMKEVDQNSGEDLNPRETD LNPDAIGVRPRTPPASTSSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNY DDESDGEDIEIELVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSN ARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILV VVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGM LLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVE ILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIF DPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTE RAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPL EPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFEN FIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQ PEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVKKRIYNPNK
view sequence (1200 aa)
>MOG-5
MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSLTATILRIVQSMTAVKKKN
KKGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAKEKEDNEDDLMAQLEKMEGRYESEKRLQKESDSKRNRSRSR
SRSRDRKRRRSRSGDRDRRRRSRSREDRRDRDRRDRDRDRDRGRGDRRGDDRQRDRRDRRDDGGARKSEVAEIGKIYDGR
VNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVNKIENGKISLSMKEVDQNSGEDLNPRETD
LNPDAIGVRPRTPPASTSSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNY
DDESDGEDIEIELVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSN
ARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILV
VVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGM
LLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVE
ILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIF
DPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTE
RAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPL
EPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFEN
FIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQ
PEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVKKRIYNPNK
Estimated Isoelectric Point:
8.56879425048828
Estimated Molecular Weight:
135.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr66
Lys87
Gln52
Leu97
Gly80
Met40
Ser80
Tyr27
His19
Glu89
Arg102
Cys11
Phe38
Pro53
Val70
Asn41
Ala79
Ile68
Trp9
Asp92