Sequence:
download
CE01671sequence.fasta
>ECT-2, isoform b MDVSMLQSPQKRIKTIQKLAVSKKDVHDFKDIFEMLEEQKEKRNINIIQYDSLDDLSGDWSEYTFFCGNFDSDLFRTLTK HQETQALFIIGASVLKNKLLKNEDLMTLRAARPLYCELMKDVTMKLAAEVPNKRELVDLVHYMGGSVRKDTVSRTNVFIA AKVEAKVQSISLVGVPTMRADWVTECWKHRDDSYFDVMEPCFVDKHRLGVFEGLSLFFHGFKQTEIDDMLRSLENTGGKL APSPTLATHVVYNPDNDEVETLAVSSNQVHVTKEWFWVSLHRGCCAIEDNFALPTGKLHRKPLESSSVSSPIGKSLRSQN SRSLSSMRDCSVEGPTSLNMTPDYIYSNDDVENSCKSPRQPSKRLRVCMEMVETEKNYLSLLKLVVKFKEALECEISHNE FMSRSDVAMMFGKLDPILELHERIFARLTVMSNEANTLLTVVNGKKNDDKNLDFAQVWIDAKEEMKKAYPQYINSYDTIK RLFDKQDRENSKFHTFCKAKESNPEFHRLKLTDLMVKPVQRLPSVILLLKEMAKKSDSKLKNNAEEAAKAIDEVLKTANK TREKNDNFISHLSKFTDIENVPPILVAANRMFIRELVVSPIASTSPGLQQFAKMKLFLFHDVLIITKIRSEKNTMQRLAR HASFASLHSRQRRPYRYIDQIQLNTMRSAFRIRAPDEIAKCLELQQQNGSTKPNVFVWCLIHRDEQGGDIDTVFESNDDE EVRDFLDDIHVKILSDCGRFFYSSDPSDMNEINDAMVSDMTTRYFRNLCGAKPQYGHGSQMNITVSERSTQNEWSHNESF MPPPQSQSRMRRAFSNAQLTLATTLGFGRNQSRNNLGQINENTTFLQSPRVSCDPAALANMTSVGGLPGCQSESESTPKR GIRSRLTSTTFLGGRHNILGRNTSMRRQATGFAHSEKELPRSKTSSYRVTDI
view sequence (932 aa)
>ECT-2, isoform b
MDVSMLQSPQKRIKTIQKLAVSKKDVHDFKDIFEMLEEQKEKRNINIIQYDSLDDLSGDWSEYTFFCGNFDSDLFRTLTK
HQETQALFIIGASVLKNKLLKNEDLMTLRAARPLYCELMKDVTMKLAAEVPNKRELVDLVHYMGGSVRKDTVSRTNVFIA
AKVEAKVQSISLVGVPTMRADWVTECWKHRDDSYFDVMEPCFVDKHRLGVFEGLSLFFHGFKQTEIDDMLRSLENTGGKL
APSPTLATHVVYNPDNDEVETLAVSSNQVHVTKEWFWVSLHRGCCAIEDNFALPTGKLHRKPLESSSVSSPIGKSLRSQN
SRSLSSMRDCSVEGPTSLNMTPDYIYSNDDVENSCKSPRQPSKRLRVCMEMVETEKNYLSLLKLVVKFKEALECEISHNE
FMSRSDVAMMFGKLDPILELHERIFARLTVMSNEANTLLTVVNGKKNDDKNLDFAQVWIDAKEEMKKAYPQYINSYDTIK
RLFDKQDRENSKFHTFCKAKESNPEFHRLKLTDLMVKPVQRLPSVILLLKEMAKKSDSKLKNNAEEAAKAIDEVLKTANK
TREKNDNFISHLSKFTDIENVPPILVAANRMFIRELVVSPIASTSPGLQQFAKMKLFLFHDVLIITKIRSEKNTMQRLAR
HASFASLHSRQRRPYRYIDQIQLNTMRSAFRIRAPDEIAKCLELQQQNGSTKPNVFVWCLIHRDEQGGDIDTVFESNDDE
EVRDFLDDIHVKILSDCGRFFYSSDPSDMNEINDAMVSDMTTRYFRNLCGAKPQYGHGSQMNITVSERSTQNEWSHNESF
MPPPQSQSRMRRAFSNAQLTLATTLGFGRNQSRNNLGQINENTTFLQSPRVSCDPAALANMTSVGGLPGCQSESESTPKR
GIRSRLTSTTFLGGRHNILGRNTSMRRQATGFAHSEKELPRSKTSSYRVTDI
Estimated Isoelectric Point:
8.45311737060547
Estimated Molecular Weight:
106.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys67
Gln37
Leu84
Gly36
Met33
Ser86
Tyr18
His24
Glu61
Arg61
Cys17
Phe45
Pro37
Val57
Asn53
Ala50
Ile44
Trp8
Asp60