Sequence:
download
CE01614sequence.fasta
>NOS-1 MLIFRTSPMSRREKSLPIEPKYTKPQANGSSFPPIFTLEGSTPCKKTARKLIDPVVNSVDSLCYLARKIVKMQEEKKRQK SNSFLIDYLVGDNFITEFREQPAQASPAVDVEDPMVSLVLGCPFGAIGQERRMSQDFPFQRRSFDMVSNRTSTSESSSCS STDNTYKNAGKFLSLQEYLEQNNLLPPSTMPFGENSGFHGYNPQMNVHNNSTRNGNVENREQRNNSTSPPRGNPPHPLCC CFCFGTASEFARLHTLPAPRKDDRGPWSDHCSKKRGRVVCPKLRSMVCGICGATGDNAHTTKHHLEAFGDD
view sequence (311 aa)
>NOS-1
MLIFRTSPMSRREKSLPIEPKYTKPQANGSSFPPIFTLEGSTPCKKTARKLIDPVVNSVDSLCYLARKIVKMQEEKKRQK
SNSFLIDYLVGDNFITEFREQPAQASPAVDVEDPMVSLVLGCPFGAIGQERRMSQDFPFQRRSFDMVSNRTSTSESSSCS
STDNTYKNAGKFLSLQEYLEQNNLLPPSTMPFGENSGFHGYNPQMNVHNNSTRNGNVENREQRNNSTSPPRGNPPHPLCC
CFCFGTASEFARLHTLPAPRKDDRGPWSDHCSKKRGRVVCPKLRSMVCGICGATGDNAHTTKHHLEAFGDD
Estimated Isoelectric Point:
8.89318084716797
Estimated Molecular Weight:
34.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys18
Gln12
Leu20
Gly19
Met9
Ser32
Tyr6
His8
Glu17
Arg22
Cys12
Phe17
Pro26
Val15
Asn21
Ala14
Ile9
Trp1
Asp15