Sequence:
download
CE01493sequence.fasta
>C16C10.2 MSSLVSISKKLSGQRQHRERSQPEARRKYGELEKKKDYKLRAEDYQKKRDTIKKLKKSAMDKNQDEYHHHMVNSETWADG RHFDKKTEAEETETQIQKKLGSLKDLEYVKFKLNEEKKKIDEMKGELHFADSSLNGKGNTHTVFVDTDSEAKSFDPRVYF DTTTSMLSRQFNRLKNEDFQNKTIIGAGTKEQVRKADRVRRTRYNELIKRVERAKELQVVVDKLELKKQLAAGSKSELKP QKVKKAKAMRAAVYKWTYERKK
view sequence (262 aa)
>C16C10.2
MSSLVSISKKLSGQRQHRERSQPEARRKYGELEKKKDYKLRAEDYQKKRDTIKKLKKSAMDKNQDEYHHHMVNSETWADG
RHFDKKTEAEETETQIQKKLGSLKDLEYVKFKLNEEKKKIDEMKGELHFADSSLNGKGNTHTVFVDTDSEAKSFDPRVYF
DTTTSMLSRQFNRLKNEDFQNKTIIGAGTKEQVRKADRVRRTRYNELIKRVERAKELQVVVDKLELKKQLAAGSKSELKP
QKVKKAKAMRAAVYKWTYERKK
Estimated Isoelectric Point:
9.83280181884766
Estimated Molecular Weight:
30.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys45
Gln13
Leu19
Gly10
Met6
Ser17
Tyr9
His7
Glu25
Arg20
Phe8
Pro3
Val14
Asn9
Ala16
Ile7
Trp2
Asp17