Sequence:
download
CE01471sequence.fasta
>ZYG-11 MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCSTSRFQINKID LMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLSGRHRITSNWPTYVARKLPRL ESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVLIMYNLNILKGDVTETLSNLTKLRVLDISRK VNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAELRAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLAT PLDSSLIEIPNRNLQVINTVSRRSIIFALSHYANLDRPAFITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLN TLPVQIAGSACLYHLCKMKRIKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDT MLLNRDASVERMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVGHERDNENALYTLKFTLSALW NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCLDGSFNEVDSK GRYREVERSYFAAGILANLLTNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFIPFSRIVRESNSNGAIMWCLW GVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDIRVVHLAREIIDIVSCHSLSSSPVRLVRRV
view sequence (799 aa)
>ZYG-11
MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCSTSRFQINKID
LMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLSGRHRITSNWPTYVARKLPRL
ESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVLIMYNLNILKGDVTETLSNLTKLRVLDISRK
VNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAELRAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLAT
PLDSSLIEIPNRNLQVINTVSRRSIIFALSHYANLDRPAFITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLN
TLPVQIAGSACLYHLCKMKRIKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDT
MLLNRDASVERMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVGHERDNENALYTLKFTLSALW
NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCLDGSFNEVDSK
GRYREVERSYFAAGILANLLTNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFIPFSRIVRESNSNGAIMWCLW
GVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDIRVVHLAREIIDIVSCHSLSSSPVRLVRRV
Estimated Isoelectric Point:
6.37723541259766
Estimated Molecular Weight:
90.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr47
Lys37
Gln30
Leu102
Gly27
Met17
Ser66
Tyr26
His26
Glu53
Arg50
Cys20
Phe22
Pro20
Val48
Asn47
Ala54
Ile58
Trp7
Asp42