Sequence:
download
CE01438sequence.fasta
>CLK-1 MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTV FSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDG MKAPAYSALKWIIQTGCKGAIAIAEKI
view sequence (187 aa)
>CLK-1
MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTV
FSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDG
MKAPAYSALKWIIQTGCKGAIAIAEKI
Estimated Isoelectric Point:
6.10945892333984
Estimated Molecular Weight:
20.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys13
Gln6
Leu19
Gly15
Met5
Ser8
Tyr4
His11
Glu16
Arg8
Cys2
Phe3
Pro4
Val12
Asn2
Ala24
Ile14
Trp2
Asp10