Sequence:
download
CE01245sequence.fasta
>TBX-2 MAFNPFALGRPDLLLPFMGAGVGGPGAGGPPPNLFFSMLQAGFPPGPVGSPPEDDGVTDDPKVELDERELWQQFSQCGTE MVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPADEHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGA NFHKLKLTNNISDKHGYTILNSMHKYQPRLHVVRCADRHNLMYSTFRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKG FRDAGAGKREKKRQLHRMNGDATQSPPGKTASLPTHSPHPSESNSEDDEPTLKKCKPEPSQTPTTSSLSTSTTPTLSAHH PLRSPQFCIPPPIDMMYQNMPMDLLAHWQMATLFPQFSMALNSPAAAASLLSKHLAKASSECKVEATSEDSEEAEKPEVK KEQKSVTPPKKGGFDVLDLLSKP
view sequence (423 aa)
>TBX-2
MAFNPFALGRPDLLLPFMGAGVGGPGAGGPPPNLFFSMLQAGFPPGPVGSPPEDDGVTDDPKVELDERELWQQFSQCGTE
MVITKSGRRIFPAYRVKISGLDKKSQYFVMMDLVPADEHRYKFNNSRWMIAGKADPEMPKTLYIHPDSPSTGEHWMSKGA
NFHKLKLTNNISDKHGYTILNSMHKYQPRLHVVRCADRHNLMYSTFRTFVFRETEFIAVTAYQNEKVTELKIENNPFAKG
FRDAGAGKREKKRQLHRMNGDATQSPPGKTASLPTHSPHPSESNSEDDEPTLKKCKPEPSQTPTTSSLSTSTTPTLSAHH
PLRSPQFCIPPPIDMMYQNMPMDLLAHWQMATLFPQFSMALNSPAAAASLLSKHLAKASSECKVEATSEDSEEAEKPEVK
KEQKSVTPPKKGGFDVLDLLSKP
Estimated Isoelectric Point:
8.13898468017578
Estimated Molecular Weight:
47.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys33
Gln15
Leu33
Gly26
Met18
Ser36
Tyr9
His15
Glu26
Arg17
Cys5
Phe21
Pro43
Val17
Asn16
Ala30
Ile11
Trp4
Asp22