Sequence:
download
CE01241sequence.fasta
>CEH-20 MVGTHPANLSELLDAVLKINEQTLDDNDSAKKQELQCHPMRQALFDVLCETKEKTVLTVRNQVDETPEDPQLMRLDNMLV AEGVAGPDKGGSLGSDASGGDQADYRQKLHQIRVLYNEELRKYEEACNEFTQHVRSLLKDQSQVRPIAHKEIERMVYIIQ RKFNGIQVQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYGHLSNPYPSEEAKEDLARQCNITVSQVSNWFG NKRIRYKKNMAKAQEEASMYAAKKNAHVTLGGMAGNPYGMLPGAAAAAGLLNPYNPMNIPGQDTLHMGMPPFDLSVYNPQ LMAAAQYQQQMDNADKNS
view sequence (338 aa)
>CEH-20
MVGTHPANLSELLDAVLKINEQTLDDNDSAKKQELQCHPMRQALFDVLCETKEKTVLTVRNQVDETPEDPQLMRLDNMLV
AEGVAGPDKGGSLGSDASGGDQADYRQKLHQIRVLYNEELRKYEEACNEFTQHVRSLLKDQSQVRPIAHKEIERMVYIIQ
RKFNGIQVQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYGHLSNPYPSEEAKEDLARQCNITVSQVSNWFG
NKRIRYKKNMAKAQEEASMYAAKKNAHVTLGGMAGNPYGMLPGAAAAAGLLNPYNPMNIPGQDTLHMGMPPFDLSVYNPQ
LMAAAQYQQQMDNADKNS
Estimated Isoelectric Point:
6.72202301025391
Estimated Molecular Weight:
38.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys22
Gln26
Leu31
Gly19
Met15
Ser17
Tyr13
His8
Glu23
Arg19
Cys5
Phe8
Pro16
Val19
Asn23
Ala31
Ile11
Trp1
Asp19