Sequence:
download
CE01029sequence.fasta
>GLY-14 MHISSKITFIFVLIYFSWNFYIQNGFTNKAIVKEELRLLKEMDEAGSRLEKLLKVEKEHMERLSETMNRATRLRITPNSN NPNNWPHPIPVIVFSCNRPDSVRAHVEKLIMYRPSAQQFPITVSQDCDNESVKKEVEKFGNSVNYVKHPPGESVKIEIPT NLQKFKPYYYISRHYKLALNHIFSNSNNYSSVIITEDDLDIAPDFFSYFSNTRYLLEKDPSLWCVTAWNDNGKPENIDLK SNATLYRSDFFAGLGWMMTRKTWEELEPIWPNGFWDDWMREPVQRKQRQCIRPEISRTGMMKYGKEGTSKGQFFSDHLEK IKVNDLPVDFSQINLDYLQKNEFESRLSLDIRNAVPVDIDDITYPDWKPDYEGMKAIIYYTGRTDFVAKADRLSLMHDFK AGVPRTAYNGIVTCFYKGTRIFLVPDRSKVPGYDSSW
view sequence (437 aa)
>GLY-14
MHISSKITFIFVLIYFSWNFYIQNGFTNKAIVKEELRLLKEMDEAGSRLEKLLKVEKEHMERLSETMNRATRLRITPNSN
NPNNWPHPIPVIVFSCNRPDSVRAHVEKLIMYRPSAQQFPITVSQDCDNESVKKEVEKFGNSVNYVKHPPGESVKIEIPT
NLQKFKPYYYISRHYKLALNHIFSNSNNYSSVIITEDDLDIAPDFFSYFSNTRYLLEKDPSLWCVTAWNDNGKPENIDLK
SNATLYRSDFFAGLGWMMTRKTWEELEPIWPNGFWDDWMREPVQRKQRQCIRPEISRTGMMKYGKEGTSKGQFFSDHLEK
IKVNDLPVDFSQINLDYLQKNEFESRLSLDIRNAVPVDIDDITYPDWKPDYEGMKAIIYYTGRTDFVAKADRLSLMHDFK
AGVPRTAYNGIVTCFYKGTRIFLVPDRSKVPGYDSSW
Estimated Isoelectric Point:
7.61806488037109
Estimated Molecular Weight:
51.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys33
Gln11
Leu30
Gly18
Met12
Ser33
Tyr21
His9
Glu28
Arg25
Cys5
Phe24
Pro26
Val25
Asn29
Ala16
Ile31
Trp11
Asp29