Sequence:
download
CE01027sequence.fasta
>MOG-1 MSDKRADGRLEGTSDTFGGLVIKKKKVEGDSKPTEPSGKSLLGLDRLASTKREHARKRLEDDDDRGVTESVRKGIEKVHE KHRDRDDRGMKYKSRDDDRRRDRDRSERREPSSRRGWKDRSGDQTPRFKVPDTPSRMSWDQDDREGSSRKRNSWDMPTPR GERDRKRYMDSERSISSAWRSERRNRDDEKRRRHRKPEDSVRSVKEEKAEPTFHDDEERAQWEEEQKNLDREWYDNEGAF DDEYNPFNKVSDEFVEKREKQWQEKTQKPRLTVKQQAIKRENELWENNRLHRSGVVAMADELSSIFEDETDENRVTILVQ NIVPPFLDGRIVFTKQAQPIIPVVDTTCDMAVSAARGSVAVRKRREVEDRKKAQDKHWELAGSKLGNLMGVKEKKDETAD PEDDDSGNYKESHQFASHMKDNEAVSDFAMEKSIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLE DGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIM DEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQ AVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELDEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAET SLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTN LANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDE VLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKE IMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYM QCVTAVDAIWLAELGPMFYSIKESKQSRKELKMESVRTVETMEAEMREAQKEMERRKEESDKAFKRPESSRRVVEVGSKS ARSERRKLWGL
view sequence (1131 aa)
>MOG-1
MSDKRADGRLEGTSDTFGGLVIKKKKVEGDSKPTEPSGKSLLGLDRLASTKREHARKRLEDDDDRGVTESVRKGIEKVHE
KHRDRDDRGMKYKSRDDDRRRDRDRSERREPSSRRGWKDRSGDQTPRFKVPDTPSRMSWDQDDREGSSRKRNSWDMPTPR
GERDRKRYMDSERSISSAWRSERRNRDDEKRRRHRKPEDSVRSVKEEKAEPTFHDDEERAQWEEEQKNLDREWYDNEGAF
DDEYNPFNKVSDEFVEKREKQWQEKTQKPRLTVKQQAIKRENELWENNRLHRSGVVAMADELSSIFEDETDENRVTILVQ
NIVPPFLDGRIVFTKQAQPIIPVVDTTCDMAVSAARGSVAVRKRREVEDRKKAQDKHWELAGSKLGNLMGVKEKKDETAD
PEDDDSGNYKESHQFASHMKDNEAVSDFAMEKSIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLE
DGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIM
DEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQ
AVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELDEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAET
SLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTN
LANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDE
VLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKE
IMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYM
QCVTAVDAIWLAELGPMFYSIKESKQSRKELKMESVRTVETMEAEMREAQKEMERRKEESDKAFKRPESSRRVVEVGSKS
ARSERRKLWGL
Estimated Isoelectric Point:
6.43822479248047
Estimated Molecular Weight:
129.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys87
Gln42
Leu82
Gly68
Met42
Ser74
Tyr25
His19
Glu99
Arg98
Cys16
Phe40
Pro48
Val74
Asn32
Ala73
Ile51
Trp15
Asp92