Sequence:
download
CE00980sequence.fasta
>F35H8.2 MANHDFCTKTMWALSVPLGVLLILFIALTAYATYSFHIFVPIAPNNEIDCAIMFNKSSEDYLTYIENRTLLETTHNDRNC FQIRRRRYLPADLPKSMSGFHNMFFIRVVSKDYDFVEEVLAMMHSPIHFFCFVLDINSEPLFKERMFRLGDCMVNVLVPR ELFNTSTAHGTLNAHRRCLREIDEFDWKHAVITAEHDIPLHSTKFLSRRSRRLRDMVEMNGIHFKEETLANANPNDTSSQ LFQVSRNWLQHLCSVATISHSQHKVLYDYLLKTPDFDLPNDQHREISVVEQKCDTMKYDVDGSCLYAMEDFSAIRNTTRL FIRADPHYDFGFVQCVHEVVFERTFFDPISNKNANNYLYGSRVNLIDDYRN
view sequence (371 aa)
>F35H8.2
MANHDFCTKTMWALSVPLGVLLILFIALTAYATYSFHIFVPIAPNNEIDCAIMFNKSSEDYLTYIENRTLLETTHNDRNC
FQIRRRRYLPADLPKSMSGFHNMFFIRVVSKDYDFVEEVLAMMHSPIHFFCFVLDINSEPLFKERMFRLGDCMVNVLVPR
ELFNTSTAHGTLNAHRRCLREIDEFDWKHAVITAEHDIPLHSTKFLSRRSRRLRDMVEMNGIHFKEETLANANPNDTSSQ
LFQVSRNWLQHLCSVATISHSQHKVLYDYLLKTPDFDLPNDQHREISVVEQKCDTMKYDVDGSCLYAMEDFSAIRNTTRL
FIRADPHYDFGFVQCVHEVVFERTFFDPISNKNANNYLYGSRVNLIDDYRN
Estimated Isoelectric Point:
6.12654876708984
Estimated Molecular Weight:
43.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys13
Gln8
Leu34
Gly8
Met13
Ser24
Tyr14
His18
Glu20
Arg26
Cys10
Phe28
Pro14
Val24
Asn25
Ala20
Ile21
Trp3
Asp27