Sequence:
download
CE00955sequence.fasta
>ACY-1 MDDDVGERTPALGGSCGPSVRAHSSSPRRVPLFERASARWWNPQFRSATLEAQYWKCSFSQLRDRFRSGLIYIAVVIAAW TLYLALFDRTFIQHWIVSLCLCAIIFAMFAFTACAAQYQRFYMPTSFLCTFLICLVTLLIFSAENQAAFMTPVASLATSF QVVLLIYTVIPLPLYLCILIGIIYSILFEILNKNKIGLEEAGYIKLVLHAGVHLLGVHLFILTQVRQRKTFLKVGQSMLA RKDLELETQFKDHMIQSVMPKKVADELLKDASELRRPSASNDSNCRTSNATQVDQPLAKMVPEYRKFRPFTMNLMTNVSI LFADIAGFTKMSSNKSADELVNLLNDLFGRFDTLCRLRGLEKISTLGDCYYCVAGCPEPCDDHACRTVEMGLDMIVAIRQ FDIDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGPL RMQVQGTERRVKPESMKTFFIKGRINDGVEEEVMQVQEVESLHSQKSSKKSTLKQKWAEKLKMNHTNSYPMRAAAREGGG SLRIKLAERNRSTQLLPKESNSICIMEDNRKSASLQALATNNFNGSNTDTNNTYSERGVAGSVSKKSVAGSESNSIKGSR SSGLQLSLQDGNSDLNSVGGLDTAISHHHNAASLTRFDTDNNFDQRLAMVIGQGEGGFDKGFWNHHDSLNKWTLRFNEKD VEEEYRAHFVDSSERYTASKKGHVERHKDLMEQGGEKDGITGSTVNKYRYSGVFIDIIVATLIFVISGAVAIMSVRPFPL SLIAYFPFAAAILILTIVLIGLPLLARKKSFQCANQWMPRHLIGLLLIFLPIGVAICIMPLCQSGDCANVILNYRLAFSY VTILAIFAHCNFSQLAAWPKTTAAVFIGLLHIAGVFYCEFNLKHLVEEQDTCNVTAIMIPPIRKGLNYTIALNSTSARTL SQDFGSPLFIWELLLDVILSIVLVAFLNYQFETAFRMSFFGDVQARRDTERMQIVRDQADWLLNNVIPAHAVESLKTDTK YSENHETVGVLFASITNWNDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNML HPKEHLYQMVDFALAVQHVLSVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVS QHTREYLLDRYEFEFRDHIEVKGIDGGMDTYLLVGRKGDGIPPSIKDNQEDEF
view sequence (1253 aa)
>ACY-1
MDDDVGERTPALGGSCGPSVRAHSSSPRRVPLFERASARWWNPQFRSATLEAQYWKCSFSQLRDRFRSGLIYIAVVIAAW
TLYLALFDRTFIQHWIVSLCLCAIIFAMFAFTACAAQYQRFYMPTSFLCTFLICLVTLLIFSAENQAAFMTPVASLATSF
QVVLLIYTVIPLPLYLCILIGIIYSILFEILNKNKIGLEEAGYIKLVLHAGVHLLGVHLFILTQVRQRKTFLKVGQSMLA
RKDLELETQFKDHMIQSVMPKKVADELLKDASELRRPSASNDSNCRTSNATQVDQPLAKMVPEYRKFRPFTMNLMTNVSI
LFADIAGFTKMSSNKSADELVNLLNDLFGRFDTLCRLRGLEKISTLGDCYYCVAGCPEPCDDHACRTVEMGLDMIVAIRQ
FDIDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGPL
RMQVQGTERRVKPESMKTFFIKGRINDGVEEEVMQVQEVESLHSQKSSKKSTLKQKWAEKLKMNHTNSYPMRAAAREGGG
SLRIKLAERNRSTQLLPKESNSICIMEDNRKSASLQALATNNFNGSNTDTNNTYSERGVAGSVSKKSVAGSESNSIKGSR
SSGLQLSLQDGNSDLNSVGGLDTAISHHHNAASLTRFDTDNNFDQRLAMVIGQGEGGFDKGFWNHHDSLNKWTLRFNEKD
VEEEYRAHFVDSSERYTASKKGHVERHKDLMEQGGEKDGITGSTVNKYRYSGVFIDIIVATLIFVISGAVAIMSVRPFPL
SLIAYFPFAAAILILTIVLIGLPLLARKKSFQCANQWMPRHLIGLLLIFLPIGVAICIMPLCQSGDCANVILNYRLAFSY
VTILAIFAHCNFSQLAAWPKTTAAVFIGLLHIAGVFYCEFNLKHLVEEQDTCNVTAIMIPPIRKGLNYTIALNSTSARTL
SQDFGSPLFIWELLLDVILSIVLVAFLNYQFETAFRMSFFGDVQARRDTERMQIVRDQADWLLNNVIPAHAVESLKTDTK
YSENHETVGVLFASITNWNDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNML
HPKEHLYQMVDFALAVQHVLSVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVS
QHTREYLLDRYEFEFRDHIEVKGIDGGMDTYLLVGRKGDGIPPSIKDNQEDEF
Estimated Isoelectric Point:
6.54727935791016
Estimated Molecular Weight:
140.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr67
Lys62
Gln45
Leu130
Gly81
Met37
Ser89
Tyr36
His31
Glu71
Arg69
Cys25
Phe70
Pro40
Val85
Asn61
Ala91
Ile82
Trp14
Asp67