Sequence:
download
CE00895sequence.fasta
>NUC-1 MGLSPAAVLIFLLLGVSQTYAAFSCKDQSGNDVDWFAVYKMPIEKDDGSVTGLAGGVAWYYVDVNKKGTLTPSAKTLDDN DQAIAYTLQQYYDKQNDKTIFHVMYNDEPWGSKSTSGIKLEEILSNRVYSNYTHEDDSTSTAFGHTKGTIFFDGTSGVWL VHSVPLFPNPTKYEYPVSGHDYGQTMLCMTFKYAQLKSIGTQLFFNRPNIYSSNLPTNMAADNADLAKAIAGQYQKGQPF QSVIELETMAGYSFTNFAKSKEFNADLYDTLVAPTLKTDLVVETWRRGSEIPLDCKLTYHANDALSIHVGSTTAFSYTKD HSKMAHSADMTKPWVCIGDINRMTSQYVRGGGTTCISSSFLWKAYSVIATQNNCA
view sequence (375 aa)
>NUC-1
MGLSPAAVLIFLLLGVSQTYAAFSCKDQSGNDVDWFAVYKMPIEKDDGSVTGLAGGVAWYYVDVNKKGTLTPSAKTLDDN
DQAIAYTLQQYYDKQNDKTIFHVMYNDEPWGSKSTSGIKLEEILSNRVYSNYTHEDDSTSTAFGHTKGTIFFDGTSGVWL
VHSVPLFPNPTKYEYPVSGHDYGQTMLCMTFKYAQLKSIGTQLFFNRPNIYSSNLPTNMAADNADLAKAIAGQYQKGQPF
QSVIELETMAGYSFTNFAKSKEFNADLYDTLVAPTLKTDLVVETWRRGSEIPLDCKLTYHANDALSIHVGSTTAFSYTKD
HSKMAHSADMTKPWVCIGDINRMTSQYVRGGGTTCISSSFLWKAYSVIATQNNCA
Estimated Isoelectric Point:
5.70154571533203
Estimated Molecular Weight:
41.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys24
Gln15
Leu27
Gly26
Met10
Ser33
Tyr22
His9
Glu11
Arg6
Cys6
Phe17
Pro14
Val22
Asn19
Ala30
Ile17
Trp7
Asp26