Sequence:
download
CE00390sequence.fasta
>LAP-1 MTQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDA SSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDA VFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEV PGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDII KMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLV APMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLFIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLL GKYTSVPMLKQ
view sequence (491 aa)
>LAP-1
MTQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDA
SSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDA
VFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEV
PGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDII
KMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLV
APMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLFIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLL
GKYTSVPMLKQ
Estimated Isoelectric Point:
6.17343902587891
Estimated Molecular Weight:
52.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys33
Gln8
Leu47
Gly48
Met14
Ser29
Tyr10
His14
Glu25
Arg14
Cys4
Phe19
Pro22
Val38
Asn22
Ala47
Ile31
Trp3
Asp28