Sequence:
download
CE00219sequence.fasta
>HCP-3 MADDTPIIEEIAEQNESVTRIMQRLKHDMQRVTSVPGFNTSAAGVNDLIDILNQYKKELEDDAANDYTEAHIHKIRLVTG KRNQYVLKLKQAEDEYHARKEQARRRASSMDFTVGRNSTNLVDYSHGRHHMPSYRRHDSSDEENYSMDGTNGDGNRAGPS NPDRGNRTGPSSSDRVRMRAGRNRVTKTRRYRPGQKALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPFGADCRIRSD AISALQEAAEAFLVEMFEGSSLISTHAKRVTLMTTDIQLYRRLCLRHL
view sequence (288 aa)
>HCP-3
MADDTPIIEEIAEQNESVTRIMQRLKHDMQRVTSVPGFNTSAAGVNDLIDILNQYKKELEDDAANDYTEAHIHKIRLVTG
KRNQYVLKLKQAEDEYHARKEQARRRASSMDFTVGRNSTNLVDYSHGRHHMPSYRRHDSSDEENYSMDGTNGDGNRAGPS
NPDRGNRTGPSSSDRVRMRAGRNRVTKTRRYRPGQKALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPFGADCRIRSD
AISALQEAAEAFLVEMFEGSSLISTHAKRVTLMTTDIQLYRRLCLRHL
Estimated Isoelectric Point:
9.25591278076172
Estimated Molecular Weight:
33.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys14
Gln13
Leu20
Gly15
Met10
Ser21
Tyr10
His10
Glu20
Arg33
Cys2
Phe6
Pro9
Val13
Asn14
Ala23
Ile15
Asp21