Sequence:
download
CE00191sequence.fasta
>RHEB-1 MSSSLQSNRQSLNRKVAVMGYPHVGKSALVLRFTQNIFPERYESTIEDQHSKHIAAFHRDYHLRVTDTAGQQEYTVFPRS CSLDINGFILVYAIDDRKSFEMCSNIYEKIVRTYGDTSIPIVIVGNKTDLSTQRVVRAEEGEELARQWDAKFVEITARES NRVHEVFELLLREIEISRGNLSPTERPNGNSPKRNPFKDDGKPCSIS
view sequence (207 aa)
>RHEB-1
MSSSLQSNRQSLNRKVAVMGYPHVGKSALVLRFTQNIFPERYESTIEDQHSKHIAAFHRDYHLRVTDTAGQQEYTVFPRS
CSLDINGFILVYAIDDRKSFEMCSNIYEKIVRTYGDTSIPIVIVGNKTDLSTQRVVRAEEGEELARQWDAKFVEITARES
NRVHEVFELLLREIEISRGNLSPTERPNGNSPKRNPFKDDGKPCSIS
Estimated Isoelectric Point:
7.01927947998047
Estimated Molecular Weight:
23.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys10
Gln8
Leu13
Gly10
Met3
Ser20
Tyr7
His6
Glu17
Arg18
Cys3
Phe9
Pro9
Val15
Asn11
Ala10
Ile15
Trp1
Asp11