Sequence:
download
CE00107sequence.fasta
>GPR-2 MDVSYYDGPKDEVIEAMLKSAVTAMKLGQYEDGKGRLEDTMEFGTSNFQLLGTIYMYYGRVCRHLNHDAKALEFFEHELN MFKLIFNYPEACDSTRRIVQQALKMEKFSKARRFAEDLIDYTSNKKNGEKYIGQARILFASVCLEGCERDVESNQDEKKK LLSICAEQIAAVKLFNENNTEGAVSETKIMLIEAKCLSLDEKYEESRRKYQECIDFAIKTDQFEAVHIAYYDKALYAETY LLFFIIRDLRSALFYATKFGKERDVVKYKSKLSEEMLRNGEFHEAYLYGLEALVSIRKLGLNEHIGDVLLTIAKCLIALG KRRQAAYFIILGSVLTINQSSFKLFYEQIDVAMNQERSETATDQDACLAIDSSPDPTSSNDMINKFVVKLEHATNVETWE MIVNGIIEDQKKPVAIEKKENEEPVDMMDLIFSMSSRMDDQRTELSAARFIPPRPVSSASKKTTKSHRILPGLRANWTKV QSMKFDGHTMNRILKRSKKSKSSLDSTNSIQGDDTRSDDVTMTSK
view sequence (525 aa)
>GPR-2
MDVSYYDGPKDEVIEAMLKSAVTAMKLGQYEDGKGRLEDTMEFGTSNFQLLGTIYMYYGRVCRHLNHDAKALEFFEHELN
MFKLIFNYPEACDSTRRIVQQALKMEKFSKARRFAEDLIDYTSNKKNGEKYIGQARILFASVCLEGCERDVESNQDEKKK
LLSICAEQIAAVKLFNENNTEGAVSETKIMLIEAKCLSLDEKYEESRRKYQECIDFAIKTDQFEAVHIAYYDKALYAETY
LLFFIIRDLRSALFYATKFGKERDVVKYKSKLSEEMLRNGEFHEAYLYGLEALVSIRKLGLNEHIGDVLLTIAKCLIALG
KRRQAAYFIILGSVLTINQSSFKLFYEQIDVAMNQERSETATDQDACLAIDSSPDPTSSNDMINKFVVKLEHATNVETWE
MIVNGIIEDQKKPVAIEKKENEEPVDMMDLIFSMSSRMDDQRTELSAARFIPPRPVSSASKKTTKSHRILPGLRANWTKV
QSMKFDGHTMNRILKRSKKSKSSLDSTNSIQGDDTRSDDVTMTSK
Estimated Isoelectric Point:
5.99367523193359
Estimated Molecular Weight:
60.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys47
Gln18
Leu46
Gly22
Met19
Ser41
Tyr21
His9
Glu46
Arg28
Cys9
Phe24
Pro10
Val25
Asn22
Ala39
Ile35
Trp2
Asp35