Sequence:
download
CBP48928sequence.fasta
>Cbr-UNC-43, isoform b MSHNYESATTSSHTSSTTKKIANAIAELVSRRSSPSIRRKTEADVLNNSARGRKVSAPGNLQHALVPCIDVVVATGALAS SSVENISASTSRDSDLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFDTYTRLCDT SMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKK QGRWLCVHVHRSTQPSTNTTVSEF
view sequence (264 aa)
>Cbr-UNC-43, isoform b
MSHNYESATTSSHTSSTTKKIANAIAELVSRRSSPSIRRKTEADVLNNSARGRKVSAPGNLQHALVPCIDVVVATGALAS
SSVENISASTSRDSDLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQKQDIVRVTQTLLDAISCKDFDTYTRLCDT
SMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKK
QGRWLCVHVHRSTQPSTNTTVSEF
Estimated Isoelectric Point:
7.11305999755859
Estimated Molecular Weight:
29.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys14
Gln12
Leu17
Gly11
Met3
Ser33
Tyr4
His9
Glu16
Arg17
Cys6
Phe7
Pro8
Val18
Asn16
Ala19
Ile13
Trp2
Asp15