Sequence:
download
CBP47381sequence.fasta
>Cbr-PTB-1, isoform c MAASQVLTSDHPYHKHDAVFRAPVNNDANRAAVKSVANGSVSNFEVGTQQQPNSVLRTIIENMMFPVSLEVLHQLFARYG KVLRIITFNKNNTFQALIQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYTNPNLPPGEMTLE QQIAISTIPGLQNLIPTNPYNFAFGANPATTFLTNQLATATAAASDSANAAALAPYLNPLGLGSANLATSIPAMRFPMLN LTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNV QMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPATVSEDKLKEMFLEAGYAVKAFKFFPKDHKMA LCQLEDIETAIDALIKMHNHKLAENAHLRVSFSKSGI
view sequence (437 aa)
>Cbr-PTB-1, isoform c
MAASQVLTSDHPYHKHDAVFRAPVNNDANRAAVKSVANGSVSNFEVGTQQQPNSVLRTIIENMMFPVSLEVLHQLFARYG
KVLRIITFNKNNTFQALIQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYTNPNLPPGEMTLE
QQIAISTIPGLQNLIPTNPYNFAFGANPATTFLTNQLATATAAASDSANAAALAPYLNPLGLGSANLATSIPAMRFPMLN
LTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNV
QMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPATVSEDKLKEMFLEAGYAVKAFKFFPKDHKMA
LCQLEDIETAIDALIKMHNHKLAENAHLRVSFSKSGI
Estimated Isoelectric Point:
9.09708404541016
Estimated Molecular Weight:
48.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys28
Gln21
Leu47
Gly17
Met13
Ser27
Tyr15
His15
Glu16
Arg14
Cys4
Phe18
Pro25
Val25
Asn37
Ala47
Ile21
Trp1
Asp18