Sequence:
download
CBP47113sequence.fasta
>Cbr-LEV-10, isoform a MYLFHIIFLLLFISRSTEAISSNRKTIFQCDQHFDESQPEGVIEFPSLPKQLAISHGVNNSKPEQQYNLQCVYTFVAGPR QRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILQSALGGRYCGTVAPHVRISLRHVMKIVLHSRSTNHEDSHGFR AKYSFIPEDKFIAGEPVSGKKCSYIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKGYRGERIRLFFTDFDIFFGGEHCP YDSITIFDGPTPSSPIIRKVCGLQQRMEIYSMTNSLLIHFNTTHPAKSDPRGFIMDYEFSSRFVNIDKLLNKQRGVTHIR GTECDVRVESNRETTHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSVDDIACPSA WVGIAIGEGNMKAVMSSTDDSIFDVTLCERIPSDSPLLGPYISEGPRMVMQFGSTDTRDDRITPIGFKATIEFKTDFGVT GESLGTSNECRFRFTSSTGFFNSPRYPANYPMDTNCTYYIVGQPGKEILLHFEQFALSGDDDSNCNDYLDVYDVFVKNGK EELRLKERYCSDTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINATADK PNGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSDSASCQKAVIRVEGAPRMEYCGTKREFFEAYLS PSNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHC SLKEKSADQTIVVAAIFCGAIFLFICILFLYLFKTKLDKKKKSKRKSDTKHRQRQPYRQQKPMHKPQFDSELSPPATSRF VHHDATGIMPPIPLHQIGTSSRDMYS
view sequence (906 aa)
>Cbr-LEV-10, isoform a
MYLFHIIFLLLFISRSTEAISSNRKTIFQCDQHFDESQPEGVIEFPSLPKQLAISHGVNNSKPEQQYNLQCVYTFVAGPR
QRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILQSALGGRYCGTVAPHVRISLRHVMKIVLHSRSTNHEDSHGFR
AKYSFIPEDKFIAGEPVSGKKCSYIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKGYRGERIRLFFTDFDIFFGGEHCP
YDSITIFDGPTPSSPIIRKVCGLQQRMEIYSMTNSLLIHFNTTHPAKSDPRGFIMDYEFSSRFVNIDKLLNKQRGVTHIR
GTECDVRVESNRETTHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSVDDIACPSA
WVGIAIGEGNMKAVMSSTDDSIFDVTLCERIPSDSPLLGPYISEGPRMVMQFGSTDTRDDRITPIGFKATIEFKTDFGVT
GESLGTSNECRFRFTSSTGFFNSPRYPANYPMDTNCTYYIVGQPGKEILLHFEQFALSGDDDSNCNDYLDVYDVFVKNGK
EELRLKERYCSDTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINATADK
PNGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSDSASCQKAVIRVEGAPRMEYCGTKREFFEAYLS
PSNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHC
SLKEKSADQTIVVAAIFCGAIFLFICILFLYLFKTKLDKKKKSKRKSDTKHRQRQPYRQQKPMHKPQFDSELSPPATSRF
VHHDATGIMPPIPLHQIGTSSRDMYS
Estimated Isoelectric Point:
6.21573638916016
Estimated Molecular Weight:
102.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys51
Gln29
Leu58
Gly60
Met19
Ser87
Tyr39
His27
Glu52
Arg49
Cys28
Phe52
Pro50
Val51
Asn35
Ala40
Ile62
Trp3
Asp59