Sequence:
download
CBP46887sequence.fasta
>Cbr-TRXR-2 MLLQAKQPTARLLSTAIQYDMIVIGGGSGGLSCSKRAAELGAKVALVDAVEPTPNGYSWGIGGTCANVGCIPKKLMHQAA IVGKELKTAETYGWKGLDQSKLSHDWSTLTKVVHDRIKGNNWVYKVQLRDMGIKYYNAFAEFVEGGNVLVTTADKKKTQT LLSAPNIILATGLRPRYPDVPGALLGITSDDLFTLSKPPGKVLVVGAGYVALECAGFLTGINQDVEVLIRSRPLKEFDKD CVNFVMGQLKSTGVKVKEGVEVAKVEEVGDGKKKVYFTENGGVGEYDTLIWAAGREPRMDKLKLDYAGVERSSKSGKILA DEYDKTSVEGIFAVGDIVEGRLELTPLAIQSGRLLAERLFAGSKQTVCFDGIATTVFTPLELSTVGLTEEEAKKKYGEDG IEVYHSHYTPFEYIVPQNEDKAYCYVKAICLRDDTQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTVAIHPCSSE EFVKLQITKRSGKDPRVQGCCG
view sequence (502 aa)
>Cbr-TRXR-2
MLLQAKQPTARLLSTAIQYDMIVIGGGSGGLSCSKRAAELGAKVALVDAVEPTPNGYSWGIGGTCANVGCIPKKLMHQAA
IVGKELKTAETYGWKGLDQSKLSHDWSTLTKVVHDRIKGNNWVYKVQLRDMGIKYYNAFAEFVEGGNVLVTTADKKKTQT
LLSAPNIILATGLRPRYPDVPGALLGITSDDLFTLSKPPGKVLVVGAGYVALECAGFLTGINQDVEVLIRSRPLKEFDKD
CVNFVMGQLKSTGVKVKEGVEVAKVEEVGDGKKKVYFTENGGVGEYDTLIWAAGREPRMDKLKLDYAGVERSSKSGKILA
DEYDKTSVEGIFAVGDIVEGRLELTPLAIQSGRLLAERLFAGSKQTVCFDGIATTVFTPLELSTVGLTEEEAKKKYGEDG
IEVYHSHYTPFEYIVPQNEDKAYCYVKAICLRDDTQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTVAIHPCSSE
EFVKLQITKRSGKDPRVQGCCG
Estimated Isoelectric Point:
7.02536773681641
Estimated Molecular Weight:
54.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys42
Gln17
Leu46
Gly53
Met7
Ser26
Tyr19
His7
Glu33
Arg18
Cys11
Phe15
Pro19
Val49
Asn12
Ala39
Ile26
Trp5
Asp27