Sequence:
download
CBP46051sequence.fasta
>Cbr-UNC-52, isoform c MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK DAACDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQ GSHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQS STSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQ GQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQ TRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHP DRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPP GYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEA TRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGL EGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITW HREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCW VPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDP PNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNV NQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNT NRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGD YICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQL PFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTP ARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGE RHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNP PGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHAT ATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSY AGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLG TEPTLEIVKADPSNDFGVYRCNVEDNNGLVIGSAYTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVEWTYDNG DLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPS AVISWTKEGNDDLPPNAQVTGGRLLFTDLQQDNAGVYRCVAKTKAGPLQTRTVLNVGSGKPDEEVVTFTVADFLPVVYTV GDPAYLSCVGKTETKPYQTVIWTKDEGDLPSGSRVDKGVLMLPSVHRNDEGSYTCEIVKEVDPVFSTVDLQVDDYVPIIN GDPIELPPLTDEEIVNFDIEITLNSSDSKGILFETKRINSGDFLAQPVDTIHHEAKISDHGTIIYEFDVGNGRQIVETTN PINPNEWNMVKIKNDKNQVTIQLNGETATIRQHSNPLPRLSLGVNRPVFIGGRHEPTSEADDFNGIIAQVLLSGQNVGLG EARIPPSVVKYNACASRNLCLNGAKCRNANNHQGFSCECSSKFHGEYCQWRSNSCHEENCNTGICLDNEESGNVFAHWVP LVFDVKKKSTFPNPLASPPKPHS
view sequence (3463 aa)
>Cbr-UNC-52, isoform c
MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD
LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH
GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD
SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG
LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ
PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS
GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA
QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ
CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP
SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV
VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC
DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF
SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR
PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK
DAACDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQ
GSHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQS
STSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQ
GQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQ
TRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHP
DRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPP
GYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEA
TRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGL
EGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITW
HREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCW
VPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDP
PNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNV
NQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNT
NRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGD
YICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQL
PFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTP
ARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGE
RHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNP
PGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHAT
ATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSY
AGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLG
TEPTLEIVKADPSNDFGVYRCNVEDNNGLVIGSAYTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVEWTYDNG
DLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPS
AVISWTKEGNDDLPPNAQVTGGRLLFTDLQQDNAGVYRCVAKTKAGPLQTRTVLNVGSGKPDEEVVTFTVADFLPVVYTV
GDPAYLSCVGKTETKPYQTVIWTKDEGDLPSGSRVDKGVLMLPSVHRNDEGSYTCEIVKEVDPVFSTVDLQVDDYVPIIN
GDPIELPPLTDEEIVNFDIEITLNSSDSKGILFETKRINSGDFLAQPVDTIHHEAKISDHGTIIYEFDVGNGRQIVETTN
PINPNEWNMVKIKNDKNQVTIQLNGETATIRQHSNPLPRLSLGVNRPVFIGGRHEPTSEADDFNGIIAQVLLSGQNVGLG
EARIPPSVVKYNACASRNLCLNGAKCRNANNHQGFSCECSSKFHGEYCQWRSNSCHEENCNTGICLDNEESGNVFAHWVP
LVFDVKKKSTFPNPLASPPKPHS
Estimated Isoelectric Point:
5.06558990478516
Estimated Molecular Weight:
380.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr198
Lys137
Gln191
Leu191
Gly262
Met19
Ser246
Tyr92
His116
Glu238
Arg181
Cys165
Phe93
Pro276
Val256
Asn165
Ala213
Ile140
Trp32
Asp252