Sequence:
download
CBP45342sequence.fasta
>Cbr-EFF-1, isoform b MSTGFGSDTIHTFTAYVSDLHAANRSMIIPLPAIVGPGARTICLRADSMADIDSICHVVEYFESPLEIDLVEGKWHEMIG TCPTCNQINFNGMMKFLNPAHWIKGISSIGDGVMIATDIVVYLGVLCILYLLITKIIIPLGKFVKCISKCFSKTYTCISE RCS
view sequence (163 aa)
>Cbr-EFF-1, isoform b
MSTGFGSDTIHTFTAYVSDLHAANRSMIIPLPAIVGPGARTICLRADSMADIDSICHVVEYFESPLEIDLVEGKWHEMIG
TCPTCNQINFNGMMKFLNPAHWIKGISSIGDGVMIATDIVVYLGVLCILYLLITKIIIPLGKFVKCISKCFSKTYTCISE
RCS
Estimated Isoelectric Point:
6.16777801513672
Estimated Molecular Weight:
17.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys8
Gln1
Leu12
Gly12
Met7
Ser13
Tyr5
His5
Glu6
Arg4
Cys9
Phe7
Pro7
Val10
Asn5
Ala9
Ile22
Trp2
Asp8