Sequence:
download
CBP45306sequence.fasta
>Cbr-PHA-4, isoform a MSSPALSEEELYLMKVIKEEQVSEDSDSEDGNATTTSDSEDVEQNVKENKKRSPKQRGKKMLPNTTVTGATDGTGSAVPT SSAASTLDYTAMNAQDYLPTYSNTALSYQPAYQYSNATNGLLNYNYNQYANQLGSNYINTTANFMQGGGISPLGFAANPT TGSASVTTSSASVVNRSSGRNSSSTASTINAAAGSPVESRSYAGGSGSSGQELTVQEFENVREKIRRQGTYGQSKPPYSY ISLITMAIQKSATRQLTLSEIYNWIMELFPYYQNHQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFE NGCYLRRQKRFKVKEREPSRKKRNAHAQQQQHVPKIEIKDEDQTVSTTSSLGAYPMVSQPTAKIEVKEELKSAASAATAS SALLDPIASAVNHSQPTSVISSVGSLGATQPQMNLNGQYSSPYIYSGDFSANLLQGQNFLNNTIYNPTSLYTSNDYNGYQ NTLYSSTNPNSAANL
view sequence (495 aa)
>Cbr-PHA-4, isoform a
MSSPALSEEELYLMKVIKEEQVSEDSDSEDGNATTTSDSEDVEQNVKENKKRSPKQRGKKMLPNTTVTGATDGTGSAVPT
SSAASTLDYTAMNAQDYLPTYSNTALSYQPAYQYSNATNGLLNYNYNQYANQLGSNYINTTANFMQGGGISPLGFAANPT
TGSASVTTSSASVVNRSSGRNSSSTASTINAAAGSPVESRSYAGGSGSSGQELTVQEFENVREKIRRQGTYGQSKPPYSY
ISLITMAIQKSATRQLTLSEIYNWIMELFPYYQNHQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFE
NGCYLRRQKRFKVKEREPSRKKRNAHAQQQQHVPKIEIKDEDQTVSTTSSLGAYPMVSQPTAKIEVKEELKSAASAATAS
SALLDPIASAVNHSQPTSVISSVGSLGATQPQMNLNGQYSSPYIYSGDFSANLLQGQNFLNNTIYNPTSLYTSNDYNGYQ
NTLYSSTNPNSAANL
Estimated Isoelectric Point:
7.64305877685547
Estimated Molecular Weight:
54.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys24
Gln33
Leu31
Gly31
Met10
Ser69
Tyr28
His7
Glu26
Arg18
Cys3
Phe11
Pro24
Val22
Asn41
Ala41
Ile18
Trp3
Asp15