Sequence:
download
CBP44604sequence.fasta
>Cbr-PTB-1, isoform a MAAIVPNSFVRMYSLKRGPDDLQLSLRNGGAAATAAVTSAGAPGAGYFANVMTADSEPKKAKLDPSLYSSQFYTTPLHHG LATSGAPVAVAPAATTAQLLTGNPITQIQGIQLSTLPQCNQTSSATTTPVSRVVHVRNIPPDLVDVELMQLCIQYGPVSN YMMLKGKSQAFVEYEEETSAAAFVTGMTAVPIQIRGRTLFAQYSTHRELKFDKSNKATSDTESVANGSVSNFEVGTQQQP NSVLRTIIENMMFPVSLEVLHQLFARYGKVLRIITFNKNNTFQALIQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKL STLNVKYNNDKSRDYTNPNLPPGEMTLEQQIAISTIPGLQNLIPTNPYNFAFGANPATTFLTNQLATATAAASDSANAAA LAPYLNPLGLGSANLATSIPAMRFPMLNLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQ AQLALTHLDKVKWHDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPATVS EDKLKEMFLEAGYAVKAFKFFPKDHKMALCQLEDIETAIDALIKMHNHKLAENAHLRVSFSKSGI
view sequence (625 aa)
>Cbr-PTB-1, isoform a
MAAIVPNSFVRMYSLKRGPDDLQLSLRNGGAAATAAVTSAGAPGAGYFANVMTADSEPKKAKLDPSLYSSQFYTTPLHHG
LATSGAPVAVAPAATTAQLLTGNPITQIQGIQLSTLPQCNQTSSATTTPVSRVVHVRNIPPDLVDVELMQLCIQYGPVSN
YMMLKGKSQAFVEYEEETSAAAFVTGMTAVPIQIRGRTLFAQYSTHRELKFDKSNKATSDTESVANGSVSNFEVGTQQQP
NSVLRTIIENMMFPVSLEVLHQLFARYGKVLRIITFNKNNTFQALIQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKL
STLNVKYNNDKSRDYTNPNLPPGEMTLEQQIAISTIPGLQNLIPTNPYNFAFGANPATTFLTNQLATATAAASDSANAAA
LAPYLNPLGLGSANLATSIPAMRFPMLNLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQ
AQLALTHLDKVKWHDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPATVS
EDKLKEMFLEAGYAVKAFKFFPKDHKMALCQLEDIETAIDALIKMHNHKLAENAHLRVSFSKSGI
Estimated Isoelectric Point:
8.91326141357422
Estimated Molecular Weight:
68.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr49
Lys35
Gln33
Leu64
Gly31
Met19
Ser44
Tyr22
His16
Glu24
Arg20
Cys6
Phe24
Pro38
Val37
Asn42
Ala68
Ile29
Trp1
Asp23