Sequence:
download
CBP43908sequence.fasta
>Cbr-UNC-52, isoform g MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK DAACDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQ GSHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQS STSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQ GQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQ TRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHP DRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPP GYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEA TRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGL EGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITW HREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCW VPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDP PNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNV NQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNT NRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGD YICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQL PFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTP ARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGE RHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNP PGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHAT ATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSY AGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLG TEPTLEIVKADPSNDFGVYRCNVEDNNGLVIGSAYTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVEWTYDNG DLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPS AVISWTKEGNDDLPPNAQVTGGRLLFTDLQQDNAGVYRCVAKTKAGPLQTRTVLNVGSGKPDEEVVTFTVADFLPVVYTV GDPAYLSCVGKTETKPYQTVIWTKDEGDLPSGSRVDKGVLMLPSVHRNDEGSYTCEIVKEVDPVFSTVDLQVDDYVPIIN GDPIELPPLTDEEIVNFDIEITLNSSDSKGILFETKRINSGDFLAQPVDTIHHEAKISDHGTIIYEFDVGNGRQIVETTN PINPNEWNMVKIKNDKNQVTIQLNGETATIRQHSNPLPRLSLGVNRPVFIGGRHEPTSEADDFNGIIAQVLLSGQNVGLG EARIPPSVVKYNACASRNLCLNGAKCRNANNHQGFSCECSSKFHGEYCQWRSNSCHEENCNTGICLDNEERQCVCPLGTS GLRCEEKIDIPQPLGFTSETSFLAVRKPVKFESIKMKLRPTADSDEHILMYFASEYGASTKQYASLSLIDQQVVLTVNKP NMEVQKVKSEPLGAGELIDVAVRQTGSALVMTVNGNQVSEIQTDTLKPGTEIFIGGLPPGLSSPDDVVEQSFQGCVYEIF INSEDIDLQNLSSSGDISSCEESNFDDDDDDDVIVATEKPEEETTTTTTEEPEPETTNTTTEEPTTGEPTEEPTEEPTTT EVPTTTTEEPMTTTTELPTTTTEEVYHFYETSRDSDPLEIEIPVETTTTTTEEPETAQILPTDSVEEGNDVSDEEDEIAH VSTVAPDTDDYSEGTLPPDSGEEVKVEDSCVDGVCPITTTDAPNNICINSTCGMNGQCVPRNKTHYTCECKLYYDGPTCS LFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQPNGVLLWQGQRPTVTQMEDYISVGIVNGHLHFSYELG GGAAHLISEDRVDDGKEHSVRFERKGREGQMKIDNYREINGRSTGILAMLNVDGNIFVGGVPEISKATGGLFSNNFVGCI ADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRMR
view sequence (4041 aa)
>Cbr-UNC-52, isoform g
MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD
LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH
GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD
SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG
LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ
PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS
GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA
QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ
CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP
SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV
VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC
DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF
SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR
PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK
DAACDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQ
GSHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQS
STSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQ
GQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQ
TRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHP
DRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPP
GYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEA
TRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGL
EGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITW
HREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCW
VPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDP
PNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNV
NQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNT
NRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGD
YICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQL
PFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTP
ARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGE
RHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNP
PGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHAT
ATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSY
AGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLG
TEPTLEIVKADPSNDFGVYRCNVEDNNGLVIGSAYTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVEWTYDNG
DLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPS
AVISWTKEGNDDLPPNAQVTGGRLLFTDLQQDNAGVYRCVAKTKAGPLQTRTVLNVGSGKPDEEVVTFTVADFLPVVYTV
GDPAYLSCVGKTETKPYQTVIWTKDEGDLPSGSRVDKGVLMLPSVHRNDEGSYTCEIVKEVDPVFSTVDLQVDDYVPIIN
GDPIELPPLTDEEIVNFDIEITLNSSDSKGILFETKRINSGDFLAQPVDTIHHEAKISDHGTIIYEFDVGNGRQIVETTN
PINPNEWNMVKIKNDKNQVTIQLNGETATIRQHSNPLPRLSLGVNRPVFIGGRHEPTSEADDFNGIIAQVLLSGQNVGLG
EARIPPSVVKYNACASRNLCLNGAKCRNANNHQGFSCECSSKFHGEYCQWRSNSCHEENCNTGICLDNEERQCVCPLGTS
GLRCEEKIDIPQPLGFTSETSFLAVRKPVKFESIKMKLRPTADSDEHILMYFASEYGASTKQYASLSLIDQQVVLTVNKP
NMEVQKVKSEPLGAGELIDVAVRQTGSALVMTVNGNQVSEIQTDTLKPGTEIFIGGLPPGLSSPDDVVEQSFQGCVYEIF
INSEDIDLQNLSSSGDISSCEESNFDDDDDDDVIVATEKPEEETTTTTTEEPEPETTNTTTEEPTTGEPTEEPTEEPTTT
EVPTTTTEEPMTTTTELPTTTTEEVYHFYETSRDSDPLEIEIPVETTTTTTEEPETAQILPTDSVEEGNDVSDEEDEIAH
VSTVAPDTDDYSEGTLPPDSGEEVKVEDSCVDGVCPITTTDAPNNICINSTCGMNGQCVPRNKTHYTCECKLYYDGPTCS
LFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQPNGVLLWQGQRPTVTQMEDYISVGIVNGHLHFSYELG
GGAAHLISEDRVDDGKEHSVRFERKGREGQMKIDNYREINGRSTGILAMLNVDGNIFVGGVPEISKATGGLFSNNFVGCI
ADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRMR
Estimated Isoelectric Point:
4.85303497314453
Estimated Molecular Weight:
443.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr265
Lys159
Gln210
Leu226
Gly304
Met31
Ser284
Tyr106
His125
Glu308
Arg202
Cys180
Phe110
Pro308
Val296
Asn187
Ala235
Ile174
Trp34
Asp297