Sequence:
download
CBP43788sequence.fasta
>Cbr-DOP-3, isoform a MLTGQHHIPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLIVSLAVSDLFVAIGVMSFGVY YEWNGFKWGLGSFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLL GVNPMENDQCELANPWFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPECGSMPNLTIIERPAPPEKEK DIELSIMDLHDTVEMLDDKYTSAMITSFRTSRSFGEELEEILPFIDGSTSVKNSREQLHATRSNTSTTRLLDVKPELRSI SVPSIQDEKKMNSRPPENPFAHQNGTNKQRLLPNPGILMKSKSTTLLKTNGYLDTDSLNNNRNSHKKSTADLLPNDDYSF TDSMRVYKNRLFKSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFILHLSNSICLVIDSNSDC IGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGFFKKR
view sequence (607 aa)
>Cbr-DOP-3, isoform a
MLTGQHHIPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLIVSLAVSDLFVAIGVMSFGVY
YEWNGFKWGLGSFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLL
GVNPMENDQCELANPWFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK
HFKNRTDQILLEISFQTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPECGSMPNLTIIERPAPPEKEK
DIELSIMDLHDTVEMLDDKYTSAMITSFRTSRSFGEELEEILPFIDGSTSVKNSREQLHATRSNTSTTRLLDVKPELRSI
SVPSIQDEKKMNSRPPENPFAHQNGTNKQRLLPNPGILMKSKSTTLLKTNGYLDTDSLNNNRNSHKKSTADLLPNDDYSF
TDSMRVYKNRLFKSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFILHLSNSICLVIDSNSDC
IGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGFFKKR
Estimated Isoelectric Point:
9.34830474853516
Estimated Molecular Weight:
68.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys28
Gln19
Leu66
Gly29
Met20
Ser62
Tyr16
His12
Glu24
Arg37
Cys10
Phe33
Pro33
Val33
Asn35
Ala35
Ile46
Trp8
Asp25