Sequence:
download
CBP43782sequence.fasta
>Cbr-RDE-2, isoform a MNMMPPNYYYQAPPMMPPNQYYQQMPPQAQFQQVYQQRPTPARAPPQPIPPHYHAVIQHQQIPQSISYPVRERPESPNKT FIHGVIIGKSKDGKDNFVLYSAKCGLCHISHEVPDLFIGQWLGITVSIPNYNGDVLLDRSNSEGYEDRDDLPDPMYTCVR YLPTREDPSLGEVVVTCRFRVFPDHETRGWAVHSYDIMFSDIIDDYKLISTSNDWFNGRIFIVEAQASMAGWVALRVTED QRKEFSCDAVSIPDGKRKLPSPLVDFNIQWLEDCDPALLKIMTGNGYVQPPEHALPPPPQDFFDELGGSVGLNQPSTSAT MASESSERELRQIDACISRATLTQDTVPAPPQTTLMAEKEETTTQQKPSESKEVLSDDEIDDEDTDGALGTHGMVKKEFL KDVSGKTYQRFQQERARTDQKPESALCVVVQKIDRIAVMYTAKRDVQNVLLYEQECEGVHEPLHLGQIAYFEISPRRMET QDELLPRAPYSHIAVRMKQYAPEFQSKFDRFKRLVRCFGGLVEMKVTIPLTRKGALEIFHLPEEESTHEQDKTFYYLHAT NGVRVSIPWDRLVPFLKTDMTADFDLVAWASHRKAVGTVNLHIGRSGEAFRKYKDGNVEELPPLSASRYLMNAKKL
view sequence (636 aa)
>Cbr-RDE-2, isoform a
MNMMPPNYYYQAPPMMPPNQYYQQMPPQAQFQQVYQQRPTPARAPPQPIPPHYHAVIQHQQIPQSISYPVRERPESPNKT
FIHGVIIGKSKDGKDNFVLYSAKCGLCHISHEVPDLFIGQWLGITVSIPNYNGDVLLDRSNSEGYEDRDDLPDPMYTCVR
YLPTREDPSLGEVVVTCRFRVFPDHETRGWAVHSYDIMFSDIIDDYKLISTSNDWFNGRIFIVEAQASMAGWVALRVTED
QRKEFSCDAVSIPDGKRKLPSPLVDFNIQWLEDCDPALLKIMTGNGYVQPPEHALPPPPQDFFDELGGSVGLNQPSTSAT
MASESSERELRQIDACISRATLTQDTVPAPPQTTLMAEKEETTTQQKPSESKEVLSDDEIDDEDTDGALGTHGMVKKEFL
KDVSGKTYQRFQQERARTDQKPESALCVVVQKIDRIAVMYTAKRDVQNVLLYEQECEGVHEPLHLGQIAYFEISPRRMET
QDELLPRAPYSHIAVRMKQYAPEFQSKFDRFKRLVRCFGGLVEMKVTIPLTRKGALEIFHLPEEESTHEQDKTFYYLHAT
NGVRVSIPWDRLVPFLKTDMTADFDLVAWASHRKAVGTVNLHIGRSGEAFRKYKDGNVEELPPLSASRYLMNAKKL
Estimated Isoelectric Point:
5.47916412353516
Estimated Molecular Weight:
72.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys32
Gln39
Leu46
Gly32
Met19
Ser39
Tyr26
His18
Glu44
Arg37
Cys10
Phe25
Pro53
Val43
Asn18
Ala38
Ile32
Trp7
Asp44