Sequence:
download
CBP42975sequence.fasta
>Cbr-UNC-52, isoform a MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK VSIDYARGDRDQLELTTSDSRQPFSPQTRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSG STDQSADVILRGNDIALQYKHREPFHPDRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQL ISVNFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTE GDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCT PCPCPGASDCYLDNEGQVACRICPAGLEGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKR QIAHPGDRVHWICQVSGFTTEKIHVEWTKVGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTATTITQYATDDALLTVSK KISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQ YGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEV GQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGIL ERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFV KRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYV PGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPV ITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQLPFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNP STLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTPARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVC SATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDF SNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPER GDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTA TGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPR VRVVSQGDNIVLKCSVQDPSARVLWWHAQEDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQSPNIVIVQQQ GPLGYVYFLTFHFFLFLSVVSMPKNKFNKIVRTSKLTKFFGVFWREISGSMDLCEYKSA
view sequence (2779 aa)
>Cbr-UNC-52, isoform a
MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD
LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH
GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD
SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG
LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ
PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS
GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA
QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ
CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP
SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV
VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC
DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF
SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR
PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK
VSIDYARGDRDQLELTTSDSRQPFSPQTRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSG
STDQSADVILRGNDIALQYKHREPFHPDRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQL
ISVNFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTE
GDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCT
PCPCPGASDCYLDNEGQVACRICPAGLEGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKR
QIAHPGDRVHWICQVSGFTTEKIHVEWTKVGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTATTITQYATDDALLTVSK
KISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQ
YGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEV
GQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGIL
ERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFV
KRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYV
PGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPV
ITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQLPFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNP
STLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTPARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVC
SATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDF
SNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPER
GDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTA
TGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPR
VRVVSQGDNIVLKCSVQDPSARVLWWHAQEDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQSPNIVIVQQQ
GPLGYVYFLTFHFFLFLSVVSMPKNKFNKIVRTSKLTKFFGVFWREISGSMDLCEYKSA
Estimated Isoelectric Point:
5.22495269775391
Estimated Molecular Weight:
306.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr160
Lys111
Gln162
Leu151
Gly197
Met14
Ser197
Tyr77
His104
Glu195
Arg155
Cys139
Phe71
Pro226
Val198
Asn121
Ala167
Ile107
Trp27
Asp200