Sequence:
download
CBP42810sequence.fasta
>Cbr-UNC-52, isoform b MKSRSSTVVVALLALLLAGNTDAARHRKYRQTYQDIDSSDETSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR WARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNVVSYGPQEVSNSNVLRQSGQCMADEKACGN NECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSDNGCKPTEF QCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC LQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPRPQPPPTAPPQRATCDTRGAVSPYPNNYGS CDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTKDAACDRLMFAGDAEGVTMSDIEERSIDRN APYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQGSHSSEPMVVLKGNQNILVHRVRNQEHVL RSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQSSTSLGDVSWEIAVDRYTPDGLALEVEQCV CPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPANP QGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQTRAHVSGQAIEFRSFEEARGQTLYWKLPE KFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHPDRENNVEIKIFETSWQRVDGQQATREHLL MTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKC ECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTE GTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLEGRLCNECAPGYTRSNKPAGRVCEPIGQV TNEDITFVQKPHEVLRVRIMEPKRQIAHPGDRVHWICQVSGFTTEKIHVEWTKVGEVSLPSNAKAYDGYLVLEGVEREHA GQYRCTATTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQT GNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCWVPGNSNVQLRWSRPGG GALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCW VPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQPQAIQPQVDPPVQT VNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPVESNPARVIVKSP IRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICTARDPDTGAPIDS TPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQLPFGSSDDRGVLTIPST QLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTPARIKWGFREELGALPE HVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKI TWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTVGEPLQVK CEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIA TVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIA SAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWHAQEDLVSFTNVANTNTLHLKHTDLCDRGF YYCTLESTNYEIGQSPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKFNKIVRTSKLTKFFGVFWREISGSMDLCEY KSA
view sequence (2323 aa)
>Cbr-UNC-52, isoform b
MKSRSSTVVVALLALLLAGNTDAARHRKYRQTYQDIDSSDETSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR
WARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNVVSYGPQEVSNSNVLRQSGQCMADEKACGN
NECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSDNGCKPTEF
QCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC
LQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPRPQPPPTAPPQRATCDTRGAVSPYPNNYGS
CDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTKDAACDRLMFAGDAEGVTMSDIEERSIDRN
APYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQGSHSSEPMVVLKGNQNILVHRVRNQEHVL
RSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQSSTSLGDVSWEIAVDRYTPDGLALEVEQCV
CPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPANP
QGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQTRAHVSGQAIEFRSFEEARGQTLYWKLPE
KFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHPDRENNVEIKIFETSWQRVDGQQATREHLL
MTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKC
ECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTE
GTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLEGRLCNECAPGYTRSNKPAGRVCEPIGQV
TNEDITFVQKPHEVLRVRIMEPKRQIAHPGDRVHWICQVSGFTTEKIHVEWTKVGEVSLPSNAKAYDGYLVLEGVEREHA
GQYRCTATTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQT
GNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCWVPGNSNVQLRWSRPGG
GALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCW
VPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQPQAIQPQVDPPVQT
VNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPVESNPARVIVKSP
IRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICTARDPDTGAPIDS
TPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQHLSFERADGRQLPFGSSDDRGVLTIPST
QLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPARFNCVAHSDTPARIKWGFREELGALPE
HVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKI
TWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTVGEPLQVK
CEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIA
TVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIA
SAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWHAQEDLVSFTNVANTNTLHLKHTDLCDRGF
YYCTLESTNYEIGQSPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKFNKIVRTSKLTKFFGVFWREISGSMDLCEY
KSA
Estimated Isoelectric Point:
5.19344329833984
Estimated Molecular Weight:
254.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr145
Lys76
Gln124
Leu137
Gly187
Met14
Ser152
Tyr71
His59
Glu145
Arg137
Cys106
Phe62
Pro203
Val176
Asn108
Ala153
Ile91
Trp26
Asp151