Sequence:
download
CBP42601sequence.fasta
>Cbr-PTB-1, isoform b MTKRGPDDLQLSLRNGGAAATAAVTSAGAPGAGYFANVMTADSEPKKAKLDPSLYSSQFYTTPLHHGLATSGAPVAVAPA ATTAQLLTGNPITQIQGIQLSTLPQCNQTSSATTTPVSRVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVE YEEETSAAAFVTGMTAVPIQIRGRTLFAQYSTHRELKFDKSNKATSDTESVANGSVSNFEVGTQQQPNSVLRTIIENMMF PVSLEVLHQLFARYGKVLRIITFNKNNTFQALIQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSR DYTNPNLPPGEMTLEQQIAISTIPGLQNLIPTNPYNFAFGANPATTFLTNQLATATAAASDSANAAALAPYLNPLGLGSA NLATSIPAMRFPMLNLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKW HDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPATVSEDKLKEMFLEAGY AVKAFKFFPKDHKMALCQLEDIETAIDALIKMHNHKLAENAHLRVSFSKSGI
view sequence (612 aa)
>Cbr-PTB-1, isoform b
MTKRGPDDLQLSLRNGGAAATAAVTSAGAPGAGYFANVMTADSEPKKAKLDPSLYSSQFYTTPLHHGLATSGAPVAVAPA
ATTAQLLTGNPITQIQGIQLSTLPQCNQTSSATTTPVSRVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVE
YEEETSAAAFVTGMTAVPIQIRGRTLFAQYSTHRELKFDKSNKATSDTESVANGSVSNFEVGTQQQPNSVLRTIIENMMF
PVSLEVLHQLFARYGKVLRIITFNKNNTFQALIQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSR
DYTNPNLPPGEMTLEQQIAISTIPGLQNLIPTNPYNFAFGANPATTFLTNQLATATAAASDSANAAALAPYLNPLGLGSA
NLATSIPAMRFPMLNLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKW
HDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPATVSEDKLKEMFLEAGY
AVKAFKFFPKDHKMALCQLEDIETAIDALIKMHNHKLAENAHLRVSFSKSGI
Estimated Isoelectric Point:
8.83528900146484
Estimated Molecular Weight:
66.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys35
Gln33
Leu63
Gly31
Met18
Ser42
Tyr21
His16
Glu24
Arg19
Cys6
Phe23
Pro37
Val35
Asn41
Ala66
Ile28
Trp1
Asp23