Sequence:
download
CBP42498sequence.fasta
>Cbr-RAD-54.L MPSKTFNPGDFVWAKFPGFPPWPAEVLQCELKRGKPNYTVRYFGSKEEGVVKFDEVDDYYEKRKRFGKSKRVKGFDQAVE EIEAIIEEKVLKMTQEGVDEVSPVQTTLAPAKTDLPPTSTSSGSDDQIIVEAPEPYAITTVKDEKEVVEESTSLCSGSSH LHPHSIEDDNQHTEVSKIPRFESPIAIERARIRLDDTDDEDFLNLLDENDETVLTESSGITEVKTEKTTLKKTEVVELIV DEEERTIPIKNSSKEIVVIENTKEAGSSDDFVSSTKRKREESPKNLPTTSSASAPAQKRRSLGYSAKATEPKNIHKSFVS PFSTSVSPTKQGLRRKKKAPPAIEPPVSVEANPFRFVNINVFNERMASESCDHNAMVAKLLSRKFSIPMEGYMLSGRSLG LGGNRRKCALFDPYHEGALILYAPEQLSEHAQLKEDKDRKVHVVADPVVGKILRPHQRDGVKFMWDCVTGVNIPEYHGCI MADEMGLGKTLQCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLNAMPVDSGKRELIIQCLNSFMS DSKMRCAIPVLIISYETFRLYANILHSGEVGIVICDEGHRLKNSENLTYQALSGLKCARRVLISGTPIQNDLLEYFSLVN FVNPGLLGTASEFRKKFENAILKGRDADASAEDQKKGEEKTKEMVSLVEKCIIRRTSALLTKYLPVKYEHIICCKNSTLQ ETLYNKLIECEKQNRITEKDKGATASALSFITHLKKLCNHPYLVYEELQKPDNRFRTKCLSVFPEAFNPKSFDPSFSGKM KVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMALCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIFCFLLSSKAGGC GLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKTCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGEDVARHFSN EQLRELFKLESASASDTHSKLKCKRCIQGLESVDPPVNADCTSDLANWFHSEKSARKVADNVLRAVFECGSISFVFHQKS HNVEAKKVEEKIEELDEDYVPSEAEDDD
view sequence (1068 aa)
>Cbr-RAD-54.L
MPSKTFNPGDFVWAKFPGFPPWPAEVLQCELKRGKPNYTVRYFGSKEEGVVKFDEVDDYYEKRKRFGKSKRVKGFDQAVE
EIEAIIEEKVLKMTQEGVDEVSPVQTTLAPAKTDLPPTSTSSGSDDQIIVEAPEPYAITTVKDEKEVVEESTSLCSGSSH
LHPHSIEDDNQHTEVSKIPRFESPIAIERARIRLDDTDDEDFLNLLDENDETVLTESSGITEVKTEKTTLKKTEVVELIV
DEEERTIPIKNSSKEIVVIENTKEAGSSDDFVSSTKRKREESPKNLPTTSSASAPAQKRRSLGYSAKATEPKNIHKSFVS
PFSTSVSPTKQGLRRKKKAPPAIEPPVSVEANPFRFVNINVFNERMASESCDHNAMVAKLLSRKFSIPMEGYMLSGRSLG
LGGNRRKCALFDPYHEGALILYAPEQLSEHAQLKEDKDRKVHVVADPVVGKILRPHQRDGVKFMWDCVTGVNIPEYHGCI
MADEMGLGKTLQCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLNAMPVDSGKRELIIQCLNSFMS
DSKMRCAIPVLIISYETFRLYANILHSGEVGIVICDEGHRLKNSENLTYQALSGLKCARRVLISGTPIQNDLLEYFSLVN
FVNPGLLGTASEFRKKFENAILKGRDADASAEDQKKGEEKTKEMVSLVEKCIIRRTSALLTKYLPVKYEHIICCKNSTLQ
ETLYNKLIECEKQNRITEKDKGATASALSFITHLKKLCNHPYLVYEELQKPDNRFRTKCLSVFPEAFNPKSFDPSFSGKM
KVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMALCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIFCFLLSSKAGGC
GLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKTCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGEDVARHFSN
EQLRELFKLESASASDTHSKLKCKRCIQGLESVDPPVNADCTSDLANWFHSEKSARKVADNVLRAVFECGSISFVFHQKS
HNVEAKKVEEKIEELDEDYVPSEAEDDD
Estimated Isoelectric Point:
6.40415191650391
Estimated Molecular Weight:
120.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr58
Lys96
Gln30
Leu88
Gly50
Met19
Ser93
Tyr24
His22
Glu90
Arg54
Cys28
Phe46
Pro53
Val75
Asn43
Ala65
Ile58
Trp9
Asp67