Sequence:
download
CBP42286sequence.fasta
>Cbr-CED-1, isoform b MRLLLLVGVLLAATWQVGYTRAPTFPDKSKSAADAINEPKGEHVCTVKTIVDDYELRKVIHQVVYNDTEQCLNPLTGFQC VVEKRGQKASYQRQLVQKEKYIKQCCEGYYQTKDNQCQPDCNPPCKKGKCVEPGKCECDPGFGGKICSSSCSIGTWGLGC SKKCDCENGANCDPELGDCICPSGFQGKRCEEECPIDKWGPNCVKSCPCQNGGKCNHEGKCVCTDGWGGEYCLNKCEEGK FGADCKFECTCQNGATCDNTNGKCLCKSGFHGALCEKPCSEGFFGAGCTQKCQCLNNQDCDSETGECKCIGWTGKQCDIG CARGRFGLQCKQKCTCPGLEFQDSNASCDAKTGECQCESGYKGANCDERKCSADTYGADCSKQCSCVMSNTVMCAPNTGF CRCKPGFYGDNCELACSKDSYGPNCEKQAMCDWTHASEADPANGKCVCKSGRSGANCSQPCPIDFYGPNCALQCECNGRG IGCHGFDGKCNCAPGYTGHRCEHHCPALTFGANCEKRCQCPAGVGCNPITGECECPAGRQGLKCDISCPEGSYGPECKLH CKCVNGKCDPETGECSCEPGFGGADCSTSCPKGKYGDACELSCDCSDSYCSRQTGKCICPLGKKGTLCDQPCEANTYGPQ CQLTTTPSQCASTDPRNGVCLTCPPGSSGHQCEQNCPQGTYGTDCASKCACADGGHGCDPTTGECICEPGYHGATCSEKC PDGKFGYACAQNCPKCAAGSSCDHISGQCVCPAGLEGATCTRPCGVGFWGNGCRQVCRCTSEFKQCNAQTGECSCPAGFQ GDRCDKPCEDGYYGPDCIKKCKCQGTATASCNRVTGVCICHPGFTGEFCHALCPESTFGLRCSKECPKDGCGDGYECDAA IGCCHVDQMSCGKAKQEFEALNGGRAKSSGATWLLILFIIGLCGVLGLAALFYRNKYQKEKDPDMPTVSFHKSPNAEDNR EFQNPLYNRQSVFPDSGAFSGSSEGGVGAAPDGLLTLEEEDLEDKKIHGGGASRNMRNHDYASLDEVAGGEGGPATSSSS GVQNRRGQNSGDVRRPLLNSEDVDDDDEDEDFEEIPHENRNSTVVVGPTTTTENPYAHIPSPDPNIQNSTNSRRAQENLY T
view sequence (1121 aa)
>Cbr-CED-1, isoform b
MRLLLLVGVLLAATWQVGYTRAPTFPDKSKSAADAINEPKGEHVCTVKTIVDDYELRKVIHQVVYNDTEQCLNPLTGFQC
VVEKRGQKASYQRQLVQKEKYIKQCCEGYYQTKDNQCQPDCNPPCKKGKCVEPGKCECDPGFGGKICSSSCSIGTWGLGC
SKKCDCENGANCDPELGDCICPSGFQGKRCEEECPIDKWGPNCVKSCPCQNGGKCNHEGKCVCTDGWGGEYCLNKCEEGK
FGADCKFECTCQNGATCDNTNGKCLCKSGFHGALCEKPCSEGFFGAGCTQKCQCLNNQDCDSETGECKCIGWTGKQCDIG
CARGRFGLQCKQKCTCPGLEFQDSNASCDAKTGECQCESGYKGANCDERKCSADTYGADCSKQCSCVMSNTVMCAPNTGF
CRCKPGFYGDNCELACSKDSYGPNCEKQAMCDWTHASEADPANGKCVCKSGRSGANCSQPCPIDFYGPNCALQCECNGRG
IGCHGFDGKCNCAPGYTGHRCEHHCPALTFGANCEKRCQCPAGVGCNPITGECECPAGRQGLKCDISCPEGSYGPECKLH
CKCVNGKCDPETGECSCEPGFGGADCSTSCPKGKYGDACELSCDCSDSYCSRQTGKCICPLGKKGTLCDQPCEANTYGPQ
CQLTTTPSQCASTDPRNGVCLTCPPGSSGHQCEQNCPQGTYGTDCASKCACADGGHGCDPTTGECICEPGYHGATCSEKC
PDGKFGYACAQNCPKCAAGSSCDHISGQCVCPAGLEGATCTRPCGVGFWGNGCRQVCRCTSEFKQCNAQTGECSCPAGFQ
GDRCDKPCEDGYYGPDCIKKCKCQGTATASCNRVTGVCICHPGFTGEFCHALCPESTFGLRCSKECPKDGCGDGYECDAA
IGCCHVDQMSCGKAKQEFEALNGGRAKSSGATWLLILFIIGLCGVLGLAALFYRNKYQKEKDPDMPTVSFHKSPNAEDNR
EFQNPLYNRQSVFPDSGAFSGSSEGGVGAAPDGLLTLEEEDLEDKKIHGGGASRNMRNHDYASLDEVAGGEGGPATSSSS
GVQNRRGQNSGDVRRPLLNSEDVDDDDEDEDFEEIPHENRNSTVVVGPTTTTENPYAHIPSPDPNIQNSTNSRRAQENLY
T
Estimated Isoelectric Point:
5.26927947998047
Estimated Molecular Weight:
119.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr60
Lys74
Gln53
Leu48
Gly138
Met7
Ser71
Tyr30
His22
Glu74
Arg36
Cys145
Phe32
Pro67
Val38
Asn55
Ala68
Ile27
Trp8
Asp68