Sequence:
download
CBP42107sequence.fasta
>Cbr-UNC-52, isoform e MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK DRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQGSHS SEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQSSTSL GDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQGQCQ CKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQTRAH VSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHPDREN NVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPPGYVG TSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAP CHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLEGRL CNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQ LGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCWVPGN SNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQT VNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQPQ AIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPV ESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICT ARDPDTGAPIDSTPATVHVTSAAAPPVVEAHQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDV TPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEV EWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQ GEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADD EPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWHAQEDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQ SPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKFNKIVRTSKLTKFFGVFWREISGSMDLCEYKSA
view sequence (2789 aa)
>Cbr-UNC-52, isoform e
MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD
LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH
GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD
SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG
LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ
PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS
GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA
QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ
CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP
SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV
VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC
DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF
SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR
PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK
DRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQGSHS
SEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQSSTSL
GDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQGQCQ
CKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQTRAH
VSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHPDREN
NVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPPGYVG
TSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAP
CHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLEGRL
CNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQ
LGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTVDRDQPARFKCWVPGN
SNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQT
VNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQPQ
AIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDEDEYICIATDPNTNRPV
ESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICT
ARDPDTGAPIDSTPATVHVTSAAAPPVVEAHQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDV
TPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEV
EWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQ
GEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADD
EPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWHAQEDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQ
SPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKFNKIVRTSKLTKFFGVFWREISGSMDLCEYKSA
Estimated Isoelectric Point:
5.24962615966797
Estimated Molecular Weight:
307.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr156
Lys110
Gln162
Leu154
Gly204
Met18
Ser201
Tyr80
His103
Glu193
Arg156
Cys147
Phe76
Pro219
Val189
Asn123
Ala169
Ile105
Trp26
Asp198