Sequence:
download
CBP41803sequence.fasta
>Cbr-UNC-52, isoform f MKSRSSTVVVALLALLLAGNTDAARHRKYRQTYQDIDSSDETSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR WARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNVVSYGPQEVSNSNVLRQSGQCMADEKACGN NECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSDNGCKPTEF QCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC LQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPRPQPPPTAPPQRATCDTRGAVSPYPNNYGS CDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTKVSIDYARGDRDQLELTTSDSRQPFSPQTR AHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHPDR ENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPPGY VGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATR APCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLEG RLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKRQIAHPGDRVHWICQVSGFTTEKIHVEWTK VGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTATTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFRCW VPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTV DRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPA PQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGS TQVSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDED EYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLA VQRAELSDEGDYICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQH LSFERADGRQLPFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPA RFNCVAHSDTPARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVV EPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVN IGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGV YTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPG LLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWHAQ EDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQSPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKFNK IVRTSKLTKFFGVFWREISGSMDLCEYKSA
view sequence (2030 aa)
>Cbr-UNC-52, isoform f
MKSRSSTVVVALLALLLAGNTDAARHRKYRQTYQDIDSSDETSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR
WARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNVVSYGPQEVSNSNVLRQSGQCMADEKACGN
NECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSDNGCKPTEF
QCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC
LQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPRPQPPPTAPPQRATCDTRGAVSPYPNNYGS
CDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTKVSIDYARGDRDQLELTTSDSRQPFSPQTR
AHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHPDR
ENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPPGY
VGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATR
APCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLEG
RLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKRQIAHPGDRVHWICQVSGFTTEKIHVEWTK
VGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTATTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFRCW
VPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQTV
DRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRDPA
PQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGS
TQVSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSDED
EYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGLLA
VQRAELSDEGDYICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAVQH
LSFERADGRQLPFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGSPA
RFNCVAHSDTPARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTAVV
EPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVN
IGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGV
YTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPG
LLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWHAQ
EDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQSPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKFNK
IVRTSKLTKFFGVFWREISGSMDLCEYKSA
Estimated Isoelectric Point:
5.21085357666016
Estimated Molecular Weight:
222.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr126
Lys70
Gln108
Leu117
Gly160
Met9
Ser132
Tyr60
His52
Glu128
Arg120
Cys91
Phe52
Pro184
Val157
Asn98
Ala127
Ile81
Trp24
Asp134