Sequence:
download
CBP41777sequence.fasta
>Cbr-RDE-2, isoform b MNMMPPNYYYQAPPMMPPNQYYQQMPPQAQFQQVYQQRPTPARAPPQPIPPHYHAVIQHQQIPQSISYPVRERPESPNKT FIHGVIIGKSKDGKDNFVLYSAKCGLCHISHEVPDLFIGQWLGITVSIPNYNGDVLLDRSNSEGYEDRDDLPDPMYTCVR YLPTREDPSLGEVVVTCRFRVFPDHETRGWAVHSYDIMFSDIIDDYKLISTSNDWFNGRIFIVEAQASMAGWVALRVTED QRKEFSCDALPSPLVDFNIQWLEDCDPALLKIMTGNGYVQPPEHALPPPPQDFFDELGGSVGLNQPSTSATMASESSERE LRQIDACISRATLTQDTVPAPPQTTLMAEKEETTTQQKPSESKEVLSDDEIDDEDTDGALGTHGMVKKEFLKDVSGKTYQ RFQQERARTDQKPESALCVVVQKIDRIAVMYTAKRDVQNVLLYEQECEGVHEPLHLGQIAYFEISPRRMETQDELLPRAP YSHIAVRMKQYAPEFQSKFDRFKRLVRCFGGLVEMKVTIPLTRKGALEIFHLPEEESTHEQDKTFYYLHATNGVRVSIPW DRLVPFLKTDMTADFDLVAWASHRKAVGTVNLHIGRSGEAFRKYKDGNVEELPPLSASRYLMNAKKL
view sequence (627 aa)
>Cbr-RDE-2, isoform b
MNMMPPNYYYQAPPMMPPNQYYQQMPPQAQFQQVYQQRPTPARAPPQPIPPHYHAVIQHQQIPQSISYPVRERPESPNKT
FIHGVIIGKSKDGKDNFVLYSAKCGLCHISHEVPDLFIGQWLGITVSIPNYNGDVLLDRSNSEGYEDRDDLPDPMYTCVR
YLPTREDPSLGEVVVTCRFRVFPDHETRGWAVHSYDIMFSDIIDDYKLISTSNDWFNGRIFIVEAQASMAGWVALRVTED
QRKEFSCDALPSPLVDFNIQWLEDCDPALLKIMTGNGYVQPPEHALPPPPQDFFDELGGSVGLNQPSTSATMASESSERE
LRQIDACISRATLTQDTVPAPPQTTLMAEKEETTTQQKPSESKEVLSDDEIDDEDTDGALGTHGMVKKEFLKDVSGKTYQ
RFQQERARTDQKPESALCVVVQKIDRIAVMYTAKRDVQNVLLYEQECEGVHEPLHLGQIAYFEISPRRMETQDELLPRAP
YSHIAVRMKQYAPEFQSKFDRFKRLVRCFGGLVEMKVTIPLTRKGALEIFHLPEEESTHEQDKTFYYLHATNGVRVSIPW
DRLVPFLKTDMTADFDLVAWASHRKAVGTVNLHIGRSGEAFRKYKDGNVEELPPLSASRYLMNAKKL
Estimated Isoelectric Point:
5.37619781494141
Estimated Molecular Weight:
71.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys30
Gln39
Leu46
Gly31
Met19
Ser38
Tyr26
His18
Glu44
Arg36
Cys10
Phe25
Pro52
Val42
Asn18
Ala38
Ile31
Trp7
Asp43