Sequence:
download
CBP41742sequence.fasta
>Cbr-HIM-14 MYSNKSLQRRRRQQVTESLSEEKFSNSLIRLNGQSLLDTTGNNTTTRNNSSDVVIVIMEGRGSSEGQIGIAMHDVRHPEI NLCEFVDSREYATLKTMINVHEAYDIVIQNGNEERGATKLLGEALMTAFPDASLQSIHAKYFKPERGQSQLESLMNAEVS TVSEGCFRRSLALGALAVLLKYIHETRCVFFRVKSLRIKEMGVNDTCMIDFVSWESLEIIDKDDASKARKCQMKQKRTLM SVLNHTVTANGYRLLRSNVLQPSTHISTIEARQESVEELIAKPQLKEKLRRTLLRAHELDRVIAMCIQTSSSWTVRESEA KINQIIKLIQTLKVIQGIRELLVSARVKSDLLNEKTEFLKDPRFDQIMNILLEKVDDSLCDGRKNSLHLQNTKCYAVKHY VAVQLDLARQTYEELIKNVEEIGAREIAEHFHNSSSVRMSFSQARGFHYTFVTREAETVTIPRHFLEVFRNRTTVTFNSR QVIACNDRLEQVVAEIFLASDVIVCDMIDQMQPMIPVLYYAMDALSTIDFLCGLATYSDSRDTCRPSFGKSFSVSQGRHP ILDWADSERTVTNDTCLTRDRRFGIITGPNMAGKSTYLKQAALISIMAQIGCFIPANYATLPVFTRIFSRMGHNDELVRN KSAFASEMSDAASIVQYADENSLVVLDELARSTSTEEGIAITYAICEKILELKSYTFLATHFLDIAALATFSNAIDNYHF LPQTEENSLKRHKLLRGQYKGPLYGFELVELSTFPDEVFEHAQQLAEQLRDQVAERRDFESERRRIKVFVSHRLRETAEY FMEAYGEKWKEEKSAVEKLKSLRNYMIEELVKIDKQEEMDQSN
view sequence (843 aa)
>Cbr-HIM-14
MYSNKSLQRRRRQQVTESLSEEKFSNSLIRLNGQSLLDTTGNNTTTRNNSSDVVIVIMEGRGSSEGQIGIAMHDVRHPEI
NLCEFVDSREYATLKTMINVHEAYDIVIQNGNEERGATKLLGEALMTAFPDASLQSIHAKYFKPERGQSQLESLMNAEVS
TVSEGCFRRSLALGALAVLLKYIHETRCVFFRVKSLRIKEMGVNDTCMIDFVSWESLEIIDKDDASKARKCQMKQKRTLM
SVLNHTVTANGYRLLRSNVLQPSTHISTIEARQESVEELIAKPQLKEKLRRTLLRAHELDRVIAMCIQTSSSWTVRESEA
KINQIIKLIQTLKVIQGIRELLVSARVKSDLLNEKTEFLKDPRFDQIMNILLEKVDDSLCDGRKNSLHLQNTKCYAVKHY
VAVQLDLARQTYEELIKNVEEIGAREIAEHFHNSSSVRMSFSQARGFHYTFVTREAETVTIPRHFLEVFRNRTTVTFNSR
QVIACNDRLEQVVAEIFLASDVIVCDMIDQMQPMIPVLYYAMDALSTIDFLCGLATYSDSRDTCRPSFGKSFSVSQGRHP
ILDWADSERTVTNDTCLTRDRRFGIITGPNMAGKSTYLKQAALISIMAQIGCFIPANYATLPVFTRIFSRMGHNDELVRN
KSAFASEMSDAASIVQYADENSLVVLDELARSTSTEEGIAITYAICEKILELKSYTFLATHFLDIAALATFSNAIDNYHF
LPQTEENSLKRHKLLRGQYKGPLYGFELVELSTFPDEVFEHAQQLAEQLRDQVAERRDFESERRRIKVFVSHRLRETAEY
FMEAYGEKWKEEKSAVEKLKSLRNYMIEELVKIDKQEEMDQSN
Estimated Isoelectric Point:
6.28858184814453
Estimated Molecular Weight:
96.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr52
Lys45
Gln39
Leu81
Gly31
Met24
Ser70
Tyr24
His21
Glu73
Arg62
Cys15
Phe36
Pro17
Val54
Asn37
Ala60
Ile56
Trp4
Asp42