Sequence:
download
CBP41163sequence.fasta
>Cbr-PHA-4, isoform b MSSPALSEEELYLMKVIKEEQVSEDSDSEDGNATTTSDSEDVEQNVKENKKRSPKQRGKKMLPNTTVTGATDGTGSAVPT SSAASTLDYTAMNAQDYLPTYSNTALSYQPAYQVSSKPYLGQTFALGTKDDSTLAFQYSNATNGLLNYNYNQYANQLGSN YINTTANFMQGGGISPLGFAANPTTGSASVTTSSASVVNRSSGRNSSSTASTINAAAGSPVESRSYAGGSGSSGQELTVQ EFENVREKIRRQGTYGQSKPPYSYISLITMAIQKSATRQLTLSEIYNWIMELFPYYQNHQQRWQNSIRHSLSFNDCFVKV ARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNAHAQQQQHVPKIEIKDEDQTVSTTSSLGAYPM VSQPTAKIEVKEELKSAASAATASSALLDPIASAVNHSQPTSVISSVGSLGATQPQMNLNGQYSSPYIYSGDFSANLLQG QNFLNNTIYNPTSLYTSNDYNGYQNTLYSSTNPNSAANL
view sequence (519 aa)
>Cbr-PHA-4, isoform b
MSSPALSEEELYLMKVIKEEQVSEDSDSEDGNATTTSDSEDVEQNVKENKKRSPKQRGKKMLPNTTVTGATDGTGSAVPT
SSAASTLDYTAMNAQDYLPTYSNTALSYQPAYQVSSKPYLGQTFALGTKDDSTLAFQYSNATNGLLNYNYNQYANQLGSN
YINTTANFMQGGGISPLGFAANPTTGSASVTTSSASVVNRSSGRNSSSTASTINAAAGSPVESRSYAGGSGSSGQELTVQ
EFENVREKIRRQGTYGQSKPPYSYISLITMAIQKSATRQLTLSEIYNWIMELFPYYQNHQQRWQNSIRHSLSFNDCFVKV
ARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNAHAQQQQHVPKIEIKDEDQTVSTTSSLGAYPM
VSQPTAKIEVKEELKSAASAATASSALLDPIASAVNHSQPTSVISSVGSLGATQPQMNLNGQYSSPYIYSGDFSANLLQG
QNFLNNTIYNPTSLYTSNDYNGYQNTLYSSTNPNSAANL
Estimated Isoelectric Point:
7.63494110107422
Estimated Molecular Weight:
56.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr43
Lys26
Gln35
Leu34
Gly33
Met10
Ser72
Tyr29
His7
Glu26
Arg18
Cys3
Phe13
Pro25
Val23
Asn41
Ala43
Ile18
Trp3
Asp17