Sequence:
download
CBP40273sequence.fasta
>Cbr-HIM-1 MRGGSSGGTGTTSNGLTSTVDSLPGKGHLHTLEIENFKSYKGKHIIGPFSRFTAIIGPNGSGKSNLMDAISFVLGERPTS LRVKKYTDLIHGAPINRPVGKKCRVTMNYKYADGTIKAFARGVNNGTSENYLDGQLVTKEAYAAEMESIQIFIKARNFLV YQGAIESIAMKNPKERTQLFEELSRSYEFQNEYEKLKNEMTKAEDDTQHNMNKRRGIAQEKREAKMEKDEAEKYQTMKNE LAAKSTMLYLHQLFHCERLIDESKEKINEQKKIIAALETTKTAEELKIQAVHTEHKKVQREVQKLNRKLDSQESALAQKQ QERLSLKVAVAHEFKKLESANKALSAAEALAENSAAQLADLKKRKADMEGQKVAYEAEVQGMMDGGDLNLSEEQRNEYQE LRNLADQESALIQRNLLTAVQVLEGHKSCLNHELRKQKEMQERVRQKEADVQRLERQIAALSTKIAETEEEHKALVKALK KLEDSVVIDKSAMGDLSKELIAVNRQLSDASGDSAEGERNQRRVEAITSLKSAFPEAVYGRLVDLCQPSHKRFNIATTKI LQKHMNSIVCDTEETAHKAIEFLKTNRFATETFLPNDALVVNPINEKLREIRRPVGVKLVFDVINVQNQNARKALQFVCG NSLVCENQDDAKALAYGGTELKDRYKAVSMDGTLFQQSGVLSGGSADLRQKAKKWDEKVVKQLREKRDNLNEKIADLQKH RRREIEVEAERGKIASIEQRLIMWKNELKSLQQNHLMRLQNELEGLNAEEEQIPPKIERWQEKVQESQAVVQNLETASNK VADEKFAGFCQRLGIESIRDYENRELRIQQEIRDKIRSFDDELEKLNYEIDFLTEQDGNKKVADEKKKVAKIDATYKEMK SKEKAAKNAEEQHIAATEEVKAVLEEKKALAAKLEAEWNEAKKASQSSLKEYTKAEKTLVAVESLMKKKQYERHSLLHSV KLGQLALPLKSGSMADVEYEDDGAPDDMSDSDSQTDGAADRPSVSDEQIQREQHIKINYDSLPHDYKEIDDDDGVRQATN RLNVEIEELQKNVSKMNAPNLRANQRMAEVREREAESSDQLEAARRKAKAIRQKFERVKTERYRRFQDFFEPVSNNIDDI YKHLSRNTSAQAFLGAENMEEPYLDGIQYNCVAPGKRFRPMDNLSGGEKTIAALALLFAVHGRNPAPFFVLDEIDAALDN TNIGKVASYICEYARDHMQIIVISLKEEFYNKADSLIGIFPYPAACTTSGVLTFDLTRFKQIGINEMTDNPPPSTPSSSS ASVAGH
view sequence (1286 aa)
>Cbr-HIM-1
MRGGSSGGTGTTSNGLTSTVDSLPGKGHLHTLEIENFKSYKGKHIIGPFSRFTAIIGPNGSGKSNLMDAISFVLGERPTS
LRVKKYTDLIHGAPINRPVGKKCRVTMNYKYADGTIKAFARGVNNGTSENYLDGQLVTKEAYAAEMESIQIFIKARNFLV
YQGAIESIAMKNPKERTQLFEELSRSYEFQNEYEKLKNEMTKAEDDTQHNMNKRRGIAQEKREAKMEKDEAEKYQTMKNE
LAAKSTMLYLHQLFHCERLIDESKEKINEQKKIIAALETTKTAEELKIQAVHTEHKKVQREVQKLNRKLDSQESALAQKQ
QERLSLKVAVAHEFKKLESANKALSAAEALAENSAAQLADLKKRKADMEGQKVAYEAEVQGMMDGGDLNLSEEQRNEYQE
LRNLADQESALIQRNLLTAVQVLEGHKSCLNHELRKQKEMQERVRQKEADVQRLERQIAALSTKIAETEEEHKALVKALK
KLEDSVVIDKSAMGDLSKELIAVNRQLSDASGDSAEGERNQRRVEAITSLKSAFPEAVYGRLVDLCQPSHKRFNIATTKI
LQKHMNSIVCDTEETAHKAIEFLKTNRFATETFLPNDALVVNPINEKLREIRRPVGVKLVFDVINVQNQNARKALQFVCG
NSLVCENQDDAKALAYGGTELKDRYKAVSMDGTLFQQSGVLSGGSADLRQKAKKWDEKVVKQLREKRDNLNEKIADLQKH
RRREIEVEAERGKIASIEQRLIMWKNELKSLQQNHLMRLQNELEGLNAEEEQIPPKIERWQEKVQESQAVVQNLETASNK
VADEKFAGFCQRLGIESIRDYENRELRIQQEIRDKIRSFDDELEKLNYEIDFLTEQDGNKKVADEKKKVAKIDATYKEMK
SKEKAAKNAEEQHIAATEEVKAVLEEKKALAAKLEAEWNEAKKASQSSLKEYTKAEKTLVAVESLMKKKQYERHSLLHSV
KLGQLALPLKSGSMADVEYEDDGAPDDMSDSDSQTDGAADRPSVSDEQIQREQHIKINYDSLPHDYKEIDDDDGVRQATN
RLNVEIEELQKNVSKMNAPNLRANQRMAEVREREAESSDQLEAARRKAKAIRQKFERVKTERYRRFQDFFEPVSNNIDDI
YKHLSRNTSAQAFLGAENMEEPYLDGIQYNCVAPGKRFRPMDNLSGGEKTIAALALLFAVHGRNPAPFFVLDEIDAALDN
TNIGKVASYICEYARDHMQIIVISLKEEFYNKADSLIGIFPYPAACTTSGVLTFDLTRFKQIGINEMTDNPPPSTPSSSS
ASVAGH
Estimated Isoelectric Point:
6.46118927001953
Estimated Molecular Weight:
145.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys124
Gln74
Leu111
Gly60
Met29
Ser81
Tyr32
His27
Glu137
Arg76
Cys11
Phe36
Pro31
Val67
Asn70
Ala124
Ile68
Trp4
Asp71