Sequence:
download
CBP39975sequence.fasta
>Cbr-LIT-1 MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILNQGIPIIPEHQLAAAAVAHHHHQLHPSVQ HQLVAGHHHHHLPQVAHHPAILPRSDVIQQPSHFALHQHLQNLVQQQQQQQALHHHQQLVGDMALVSHTHPAAVGSTTCY EKNPQKQQQVPQIPTQPQFQVAHVSSNAILAAAQPFYQPPVQDSQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQ NLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQTLTIDHVKVFVYQILRGLKY LHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDSRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAEL LQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGPRAPNLQSLYRLSQQTTDDAVDLLVKLLKFNPDE RISVEEALSHPYLEEGRLRFHSCMCSCCYTKANVPSRIFSQELDPKHESPFDPKWEKDMSRLSMFELREKMYQFVMDRPA LYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
view sequence (596 aa)
>Cbr-LIT-1
MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILNQGIPIIPEHQLAAAAVAHHHHQLHPSVQ
HQLVAGHHHHHLPQVAHHPAILPRSDVIQQPSHFALHQHLQNLVQQQQQQQALHHHQQLVGDMALVSHTHPAAVGSTTCY
EKNPQKQQQVPQIPTQPQFQVAHVSSNAILAAAQPFYQPPVQDSQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQ
NLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQTLTIDHVKVFVYQILRGLKY
LHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDSRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAEL
LQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGPRAPNLQSLYRLSQQTTDDAVDLLVKLLKFNPDE
RISVEEALSHPYLEEGRLRFHSCMCSCCYTKANVPSRIFSQELDPKHESPFDPKWEKDMSRLSMFELREKMYQFVMDRPA
LYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
Estimated Isoelectric Point:
7.98357391357422
Estimated Molecular Weight:
66.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys23
Gln56
Leu62
Gly26
Met14
Ser50
Tyr17
His34
Glu25
Arg28
Cys12
Phe21
Pro39
Val38
Asn22
Ala53
Ile29
Trp5
Asp24