Sequence:
download
CBP38491sequence.fasta
>Cbr-PNG-1 MPVREVSRLPELNEILEKSDSNRLIIVDFFANWCGPCRMISPAFERLSMEFGNATFLKVNTDLARDIVMRYSISAMPTFL FFKNKQQVDSVRGANESAIISTIRKHYSSTPANPNAASDEEKKFLERFVGYTELRKMHTDEVFKALARSVMPDGISDRLE NGEDEKKVLQELLDWFKNDFFTWFDRPTCLKCTLKCTTEGLNGTPTKEEKEGGAGRVEVFICNGCNSEMRFPRYNDPSKL LQTRTGRCGEWANCFGLILSAAGLENRFVLDTTDHVWNEVYLKKEQRWIHVDPCENTMDRPLLYTRGWKKQLKYCIAYGH DHVTDVTWRYVFDSKKLVTQERNVRQGVLENFLGKLNARQMAGATEERKRELAVRRVCELMGMMVQEAKNQRIGWEKLGE DMGGRTTGSKEWRRARGELGDNPEAQVLGKPIEFRIQNDANHVEFSYDVNRDSYSQTPEKGFVAQTFECNNIQRKVENDW KMVYLCREDGKKEGNISWHFNLAPLVATDSKKTIEKVEIRMAGIRKFENGNILIIACLGDTCMRIPASGNLTIEDPKPEV LKITVTLSGGERNQAFQHAQLFRTEKDDVAEATESMVVRVYMK
view sequence (603 aa)
>Cbr-PNG-1
MPVREVSRLPELNEILEKSDSNRLIIVDFFANWCGPCRMISPAFERLSMEFGNATFLKVNTDLARDIVMRYSISAMPTFL
FFKNKQQVDSVRGANESAIISTIRKHYSSTPANPNAASDEEKKFLERFVGYTELRKMHTDEVFKALARSVMPDGISDRLE
NGEDEKKVLQELLDWFKNDFFTWFDRPTCLKCTLKCTTEGLNGTPTKEEKEGGAGRVEVFICNGCNSEMRFPRYNDPSKL
LQTRTGRCGEWANCFGLILSAAGLENRFVLDTTDHVWNEVYLKKEQRWIHVDPCENTMDRPLLYTRGWKKQLKYCIAYGH
DHVTDVTWRYVFDSKKLVTQERNVRQGVLENFLGKLNARQMAGATEERKRELAVRRVCELMGMMVQEAKNQRIGWEKLGE
DMGGRTTGSKEWRRARGELGDNPEAQVLGKPIEFRIQNDANHVEFSYDVNRDSYSQTPEKGFVAQTFECNNIQRKVENDW
KMVYLCREDGKKEGNISWHFNLAPLVATDSKKTIEKVEIRMAGIRKFENGNILIIACLGDTCMRIPASGNLTIEDPKPEV
LKITVTLSGGERNQAFQHAQLFRTEKDDVAEATESMVVRVYMK
Estimated Isoelectric Point:
7.46062469482422
Estimated Molecular Weight:
69.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys43
Gln19
Leu46
Gly39
Met19
Ser28
Tyr13
His9
Glu55
Arg46
Cys16
Phe29
Pro21
Val40
Asn36
Ala35
Ile28
Trp12
Asp33