Sequence:
download
CBP38411sequence.fasta
>Cbr-UNC-52, isoform d MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK DAACDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQ GSHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQS STSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQ GQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQ TRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHP DRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPP GYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEA TRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGL EGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKRQIAHPGDRVHWICQVSGFTTEKIHVEW TKVGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTATTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFR CWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQ TVDRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRD PAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPD GSTQVSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSD EDEYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGL LAVQRAELSDEGDYICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAV QHLSFERADGRQLPFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGS PARFNCVAHSDTPARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTA VVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGV VNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNA GVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNE PGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWH AQEDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQSPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKF NKIVRTSKLTKFFGVFWREISGSMDLCEYKSA
view sequence (3072 aa)
>Cbr-UNC-52, isoform d
MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKHTARVVDFKYHKIIGSLVYVD
LYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDH
GKCKQHQPIIHQTEKIVFAQKHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD
SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQCPDGDDEENCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHHNHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHG
LCCPISKTRKRQSECLEGQFKCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ
PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQDQPAAPIPPPAPAPASAEKMS
GRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEYFKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQA
QQHPAQPAQPSHDAHEEHRRRLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ
CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNYPDQDIDSSDETSDVQITVFP
SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTVEARATLNV
VSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAMSRTCEPNEFKCNNNKCVQKMWLC
DGDDDCGDNSDELNCNAKPSDNGCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTF
SLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDEQPR
PQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGYYRTK
DAACDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFKTGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQ
GSHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQS
STSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLGTCVPIQPRHQQCGPGALAPTAPAQ
GQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCFCSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQ
TRAHVSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHREPFHP
DRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISVNFEYAEPYGQGLTAAEVEQCICPP
GYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEA
TRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGL
EGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKRQIAHPGDRVHWICQVSGFTTEKIHVEW
TKVGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTATTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFR
CWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVDPVRQ
TVDRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQYICTATDPRDNIPLQSEPVQLNIRD
PAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPD
GSTQVSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRTLKSD
EDEYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGHPNVQLSFRRASGQLNEDADENNGL
LAVQRAELSDEGDYICTARDPDTGAPIDSTPATVHVTSAAAPPVVEAQTPHPVITPQTQTVPEGDPARIQCSVPGVPSAV
QHLSFERADGRQLPFGSSDDRGVLTIPSTQLQDAGEYICVYEPENQHPQRTNPSTLNVTPEGAPPRPVATPPLLQVAPGS
PARFNCVAHSDTPARIKWGFREELGALPEHVNQDGDDLVISAAGDDNVGEYVCSATNDYGTGVADPVRLEVTEDQEPPTA
VVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHDVTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGV
VNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNA
GVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRLEWEKVDDQLPTDVEEHNE
PGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDADDEPKVEIEPPRVRVVSQGDNIVLKCSVQDPSARVLWWH
AQEDLVSFTNVANTNTLHLKHTDLCDRGFYYCTLESTNYEIGQSPNIVIVQQQGPLGYVYFLTFHFFLFLSVVSMPKNKF
NKIVRTSKLTKFFGVFWREISGSMDLCEYKSA
Estimated Isoelectric Point:
5.21234893798828
Estimated Molecular Weight:
338.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr179
Lys117
Gln178
Leu171
Gly224
Met19
Ser217
Tyr88
His111
Glu212
Arg172
Cys154
Phe81
Pro245
Val217
Asn131
Ala193
Ile117
Trp29
Asp217