Sequence:
download
CBP38303sequence.fasta
>Cbr-DOP-3, isoform f MVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLIVSLAVSDLFVAIGVMSFGVYYEWNGFKWGLGSFFC HVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLLGVNPMENDQCELANP WFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGKHFKNRTDQILLEISF QTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPECGSMPNLTIIERPAPPEKEKDIELSIMDLHDTVEM LDDKYTSAMITRSNTSTTRLLDVKPELRSISVPSIQDEKKMNSRPPENPFAHQNGTNKQRLLPNPGILMKSKSTTLLKTN GYLDTDSLNNNRNSHKKSTADLLPNDDYSFTDSMRVYKNRLFKSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVV LAVFLFCWLPFFILHLSNSICLVIDSNSDCIGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGFFKKR
view sequence (557 aa)
>Cbr-DOP-3, isoform f
MVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLIVSLAVSDLFVAIGVMSFGVYYEWNGFKWGLGSFFC
HVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLLGVNPMENDQCELANP
WFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGKHFKNRTDQILLEISF
QTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPECGSMPNLTIIERPAPPEKEKDIELSIMDLHDTVEM
LDDKYTSAMITRSNTSTTRLLDVKPELRSISVPSIQDEKKMNSRPPENPFAHQNGTNKQRLLPNPGILMKSKSTTLLKTN
GYLDTDSLNNNRNSHKKSTADLLPNDDYSFTDSMRVYKNRLFKSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVV
LAVFLFCWLPFFILHLSNSICLVIDSNSDCIGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGFFKKR
Estimated Isoelectric Point:
9.49869537353516
Estimated Molecular Weight:
62.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys27
Gln17
Leu61
Gly25
Met19
Ser55
Tyr16
His9
Glu18
Arg34
Cys10
Phe30
Pro30
Val32
Asn34
Ala34
Ile42
Trp8
Asp24