Sequence:
download
CBP34552sequence.fasta
>Cbr-ACR-17 MKNLQLLLRILVLQYLVVSGCTQQKQLIKYLFRDYHKELRPVKDESSGPTNVTVQLYFKQIQKVHENDQIITLYCWIEEY WQDEFLMWNPSDFGNIKSLHVPSEMIWKPDLLVYNNANMNIKENEMQTNVQIEHTGKISLFRAIITDITCDLQMEKFPYD QQICFIMLASWSYDGSQIMLNTAEQPTEAPLDIKNTTNLAILNHYIPNMEWKLVDFRYRNNLKYYDCCPNPYPDISYFFA IKRNPSYYLFTLIIPSAFITIVTVIGFFTPHSSTGENTEKVSLGVTALLSLAIILMMVSDKLPATSNSVPLLGQYYIGLI FIMFLATYCTTFTLGIQMQGNAGRPITRRLRSFLLSIRMNRNSFVQWFFGRELMNTQESIKMRLKKYDKLSELKKKFANG FIQFQQKLLKTDEPKHNKTSLVEQESIDSSKLLDPAMYNVVVDVLSSVQSIRQDLTSQEHLKRIRKEWQMLARMLEKIIM WVFIISTVLFASFMLYDTQDPPYITNEVMRSKST
view sequence (514 aa)
>Cbr-ACR-17
MKNLQLLLRILVLQYLVVSGCTQQKQLIKYLFRDYHKELRPVKDESSGPTNVTVQLYFKQIQKVHENDQIITLYCWIEEY
WQDEFLMWNPSDFGNIKSLHVPSEMIWKPDLLVYNNANMNIKENEMQTNVQIEHTGKISLFRAIITDITCDLQMEKFPYD
QQICFIMLASWSYDGSQIMLNTAEQPTEAPLDIKNTTNLAILNHYIPNMEWKLVDFRYRNNLKYYDCCPNPYPDISYFFA
IKRNPSYYLFTLIIPSAFITIVTVIGFFTPHSSTGENTEKVSLGVTALLSLAIILMMVSDKLPATSNSVPLLGQYYIGLI
FIMFLATYCTTFTLGIQMQGNAGRPITRRLRSFLLSIRMNRNSFVQWFFGRELMNTQESIKMRLKKYDKLSELKKKFANG
FIQFQQKLLKTDEPKHNKTSLVEQESIDSSKLLDPAMYNVVVDVLSSVQSIRQDLTSQEHLKRIRKEWQMLARMLEKIIM
WVFIISTVLFASFMLYDTQDPPYITNEVMRSKST
Estimated Isoelectric Point:
8.57851409912109
Estimated Molecular Weight:
60.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys34
Gln31
Leu57
Gly15
Met22
Ser37
Tyr24
His8
Glu26
Arg20
Cys7
Phe27
Pro22
Val27
Asn30
Ala17
Ile45
Trp9
Asp23