Sequence:
download
CBP29531sequence.fasta
>Cbr-CED-10 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLV CFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSAL TQRGLKQVFDEAIRAVLTPPQRAKKNKCIVL
view sequence (191 aa)
>Cbr-CED-10
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLV
CFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSAL
TQRGLKQVFDEAIRAVLTPPQRAKKNKCIVL
Estimated Isoelectric Point:
8.50257110595703
Estimated Molecular Weight:
21.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys11
Gln9
Leu17
Gly10
Met3
Ser7
Tyr8
His2
Glu10
Arg13
Cys6
Phe6
Pro12
Val19
Asn9
Ala15
Ile9
Trp2
Asp11