Sequence:
download
CBP25226sequence.fasta
>Cbr-ZYG-12, isoform a MLDLTNQESDSSENGNSKYADSTDGRGIGTSRRLDDEDLDERRKDLADLVFWMSGLKATTLPLDDHTSLCNGRAFAEILH EIDRSFFDERWLETMPEMRTSSNLVVKRSNLRKLWRKMSDYIQVLNRKVVSTRWTEIGDRLDGLDETDIPVAADLAMAVV SLAFIGKTQEKYIQYSQELPAGEHQHMMANVARLVQIVMEELPEVPTFHEISELDGSQNELNSSHVESSVITNGNGSAER RSTLSANDQVLVEAQLEIDELRSERDNLIKDVERLTKALESSQLDTSTCSEPNELSILEKQNEELRVKRRQAEERVLELE ASMEHFQAIVVKLTDENDTLQSGQKELNMLKTHLDTAQSDVEEWRTIANKYQSDAEMLKKREKEVKELQGQVKSLTSRLE HHVKTATIDEDNKAGIVQLRSQIGTLTANNVELNVGLESKKRIVEQLELQLIQYKEKVKELEDRKEDLIAERNELENKLL FKESVTPRSLHESMFEAGHLSFDDKTKLPLEIENKRLTERIQELESLEPLKGEIIKMKSQNGVLEEEKLVITKQMEELER QVADLQEKLTKNQQHASGDVVELKVQLEKANVEVERMRETEMRTEAKLAGVEELLRKRNVEKEANETALQKAKAVIDELE SRNRPVGEDNKTSVQDFKELKTENELLRQKNEALETALNTTTQSLEQENRLITSAAHQQILDRSSDSMMIMRAQAGSDHP QTLLDTQKMTRALPWRFGISSMLIIFMVWFFINTFCEVNAPPKA
view sequence (764 aa)
>Cbr-ZYG-12, isoform a
MLDLTNQESDSSENGNSKYADSTDGRGIGTSRRLDDEDLDERRKDLADLVFWMSGLKATTLPLDDHTSLCNGRAFAEILH
EIDRSFFDERWLETMPEMRTSSNLVVKRSNLRKLWRKMSDYIQVLNRKVVSTRWTEIGDRLDGLDETDIPVAADLAMAVV
SLAFIGKTQEKYIQYSQELPAGEHQHMMANVARLVQIVMEELPEVPTFHEISELDGSQNELNSSHVESSVITNGNGSAER
RSTLSANDQVLVEAQLEIDELRSERDNLIKDVERLTKALESSQLDTSTCSEPNELSILEKQNEELRVKRRQAEERVLELE
ASMEHFQAIVVKLTDENDTLQSGQKELNMLKTHLDTAQSDVEEWRTIANKYQSDAEMLKKREKEVKELQGQVKSLTSRLE
HHVKTATIDEDNKAGIVQLRSQIGTLTANNVELNVGLESKKRIVEQLELQLIQYKEKVKELEDRKEDLIAERNELENKLL
FKESVTPRSLHESMFEAGHLSFDDKTKLPLEIENKRLTERIQELESLEPLKGEIIKMKSQNGVLEEEKLVITKQMEELER
QVADLQEKLTKNQQHASGDVVELKVQLEKANVEVERMRETEMRTEAKLAGVEELLRKRNVEKEANETALQKAKAVIDELE
SRNRPVGEDNKTSVQDFKELKTENELLRQKNEALETALNTTTQSLEQENRLITSAAHQQILDRSSDSMMIMRAQAGSDHP
QTLLDTQKMTRALPWRFGISSMLIIFMVWFFINTFCEVNAPPKA
Estimated Isoelectric Point:
4.98110198974609
Estimated Molecular Weight:
87.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr47
Lys55
Gln43
Leu91
Gly26
Met23
Ser56
Tyr6
His15
Glu99
Arg49
Cys3
Phe16
Pro15
Val47
Asn39
Ala46
Ile35
Trp7
Asp46