Sequence:
download
CBP17600sequence.fasta
>Cbr-DCS-1 MKRVASTKLSEEERTEQTSQVWLQNAKFQEVLGADSSHKSLFLLLSQPDGSQGILLANKSPFSEDKSDIEKLLETAKLQE ISRNDIFGSYNIEVDGKLNLLKSQLIYPVNDRLIAKYRQEEKFVIRETPELYETVTKPYIEKFQLNLNWVYNCLEKRSEV DKIVYEDPDKNNGFLLLQDIKWDGKTIENLYVLAIIHRHGLKSVRDLTGDDLEMLYNIRDKSLTAINEKYGLQKDQIKCY FHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELSSDHYKKSTLTFTRKNGDKLMEMFREATASK
view sequence (312 aa)
>Cbr-DCS-1
MKRVASTKLSEEERTEQTSQVWLQNAKFQEVLGADSSHKSLFLLLSQPDGSQGILLANKSPFSEDKSDIEKLLETAKLQE
ISRNDIFGSYNIEVDGKLNLLKSQLIYPVNDRLIAKYRQEEKFVIRETPELYETVTKPYIEKFQLNLNWVYNCLEKRSEV
DKIVYEDPDKNNGFLLLQDIKWDGKTIENLYVLAIIHRHGLKSVRDLTGDDLEMLYNIRDKSLTAINEKYGLQKDQIKCY
FHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELSSDHYKKSTLTFTRKNGDKLMEMFREATASK
Estimated Isoelectric Point:
5.96323394775391
Estimated Molecular Weight:
36.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys30
Gln14
Leu40
Gly11
Met5
Ser24
Tyr15
His8
Glu25
Arg12
Cys2
Phe12
Pro8
Val14
Asn18
Ala13
Ile20
Trp3
Asp22