Sequence:
download
CBP11524sequence.fasta
>Cbr-CDO-1 MVSFVQLVVQIREIFEHKMVDVDEVMKLMGSYKSDINEWRRFAIFDMNKYTRNLVDIGNGKYNLMILCWGPGMASSVHDH TDAHCFVKILDGELTETKYDWPKKKHTPLETIENKTYGLNGVSYMNDELGLHRMENQSHSNGAVSLHLYIPPYSTCNAFD ERTGKKTKCTVTFYSKYGEKIDYHGSKEGK
view sequence (190 aa)
>Cbr-CDO-1
MVSFVQLVVQIREIFEHKMVDVDEVMKLMGSYKSDINEWRRFAIFDMNKYTRNLVDIGNGKYNLMILCWGPGMASSVHDH
TDAHCFVKILDGELTETKYDWPKKKHTPLETIENKTYGLNGVSYMNDELGLHRMENQSHSNGAVSLHLYIPPYSTCNAFD
ERTGKKTKCTVTFYSKYGEKIDYHGSKEGK
Estimated Isoelectric Point:
6.74915313720703
Estimated Molecular Weight:
21.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys18
Gln3
Leu13
Gly14
Met9
Ser12
Tyr11
His9
Glu13
Arg6
Cys4
Phe7
Pro5
Val13
Asn11
Ala5
Ile10
Trp3
Asp12