Sequence:
download
CBP10634sequence.fasta
>Cbr-SUN-1 MALRHTISPQLSNRPSPPITRSVSRNGHRPTFETSTPVTRRSLQPGMEIGTIERVFEQADDSTIDLNSSKFVYKEHFTVK ERTSMQKEMWYDWLVYHIRMIRRHLFPNTEKIRETLLVLVLLFILHKYALDCWYDPTTKAEQPINHQSRIEFDSKWTPEI ERIIEESNKNLQMSISIIKDRENQLEDRTTHLETLSDDEKGWKESVVEEIRKIKASQTAIDQLVESLKKDLEENKLSKVI ITEEDRQPTGPPEPPGSSSSILLHPMHFLHRSPIGVNVANSLIGASIDYSCSSRPVSAKDGIFYDIMSYFGSFKEGYVLL DREVLTPGEAWCTYDKRPTLTVKLARFVIPTAVSYQHVRWSGIVPNHAPKLYDLVACLDSCCTQSEPLILNCEYTASEEG PDEQEQFCSIPTINSMQPINHVQFRFRENHGNMTKTCAYLVRVYGKPVNPQPPLTEQDAAALDNGTTSHLESTLVDSVPE SA
view sequence (482 aa)
>Cbr-SUN-1
MALRHTISPQLSNRPSPPITRSVSRNGHRPTFETSTPVTRRSLQPGMEIGTIERVFEQADDSTIDLNSSKFVYKEHFTVK
ERTSMQKEMWYDWLVYHIRMIRRHLFPNTEKIRETLLVLVLLFILHKYALDCWYDPTTKAEQPINHQSRIEFDSKWTPEI
ERIIEESNKNLQMSISIIKDRENQLEDRTTHLETLSDDEKGWKESVVEEIRKIKASQTAIDQLVESLKKDLEENKLSKVI
ITEEDRQPTGPPEPPGSSSSILLHPMHFLHRSPIGVNVANSLIGASIDYSCSSRPVSAKDGIFYDIMSYFGSFKEGYVLL
DREVLTPGEAWCTYDKRPTLTVKLARFVIPTAVSYQHVRWSGIVPNHAPKLYDLVACLDSCCTQSEPLILNCEYTASEEG
PDEQEQFCSIPTINSMQPINHVQFRFRENHGNMTKTCAYLVRVYGKPVNPQPPLTEQDAAALDNGTTSHLESTLVDSVPE
SA
Estimated Isoelectric Point:
5.71222686767578
Estimated Molecular Weight:
55.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys25
Gln19
Leu40
Gly17
Met10
Ser45
Tyr15
His16
Glu41
Arg28
Cys9
Phe15
Pro33
Val29
Asn19
Ala20
Ile34
Trp7
Asp25