Sequence:
download
CBP10034sequence.fasta
>Cbr-MRG-1, isoform b MPLERYKEKEEFVCIYNGGAYAARIQSVHEKPDSEGFYIVHYQGWAKRFDEKIRFEEQEDRMFPGTLTDYHAKFGVPNDP KSKKAPKRKSTVARYASSDDESAPSAKTTKKSTKRKRFPYPTVSTNFELPPALATMLVDDYTAIRKGFVSKIPAEHSIDR IITDYIKTLPAKNADLENIDDVVIEYDSTDIRITNLAMICTARGVADYFNAVCGVQLLYHQERHQHLELIRMKALEMNLP AHAATNTVVDRGFRHSQEYGIIHLVRLLSKLPELLAHTDWEHRILSRIMTGIRDLVGFLDKNRSHYHKGAEMYESSAKAK VELCEKEEKSEKLAKKSRKSAKNEQSAVEIRF
view sequence (352 aa)
>Cbr-MRG-1, isoform b
MPLERYKEKEEFVCIYNGGAYAARIQSVHEKPDSEGFYIVHYQGWAKRFDEKIRFEEQEDRMFPGTLTDYHAKFGVPNDP
KSKKAPKRKSTVARYASSDDESAPSAKTTKKSTKRKRFPYPTVSTNFELPPALATMLVDDYTAIRKGFVSKIPAEHSIDR
IITDYIKTLPAKNADLENIDDVVIEYDSTDIRITNLAMICTARGVADYFNAVCGVQLLYHQERHQHLELIRMKALEMNLP
AHAATNTVVDRGFRHSQEYGIIHLVRLLSKLPELLAHTDWEHRILSRIMTGIRDLVGFLDKNRSHYHKGAEMYESSAKAK
VELCEKEEKSEKLAKKSRKSAKNEQSAVEIRF
Estimated Isoelectric Point:
8.86273956298828
Estimated Molecular Weight:
40.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys33
Gln8
Leu25
Gly14
Met8
Ser23
Tyr16
His14
Glu30
Arg24
Cys4
Phe13
Pro15
Val19
Asn11
Ala31
Ile22
Trp2
Asp21